Comparing WP_011384082.1 NCBI__GCF_000009985.1:WP_011384082.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
33% identity, 99% coverage: 1:250/253 of query aligns to 2:253/253 of 1g9xB
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
33% identity, 99% coverage: 1:250/253 of query aligns to 2:253/254 of 1g6hA
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
29% identity, 98% coverage: 2:250/253 of query aligns to 1:235/240 of 6mjpA
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
30% identity, 98% coverage: 4:250/253 of query aligns to 3:235/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
30% identity, 98% coverage: 4:250/253 of query aligns to 3:235/238 of 6s8gA
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
30% identity, 98% coverage: 4:250/253 of query aligns to 3:235/235 of 6mhzA
6mbnA Lptb e163q in complex with atp (see paper)
30% identity, 98% coverage: 4:250/253 of query aligns to 4:236/241 of 6mbnA
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
30% identity, 97% coverage: 4:249/253 of query aligns to 3:234/234 of 6b89A
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
30% identity, 97% coverage: 4:249/253 of query aligns to 3:234/234 of 4p31A
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
30% identity, 96% coverage: 6:249/253 of query aligns to 4:236/240 of 4ymuJ
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
30% identity, 97% coverage: 4:248/253 of query aligns to 3:233/233 of 6b8bA
1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
29% identity, 98% coverage: 3:251/253 of query aligns to 6:239/240 of 1ji0A
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
31% identity, 96% coverage: 1:242/253 of query aligns to 1:232/353 of 1oxvD
1oxvA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
31% identity, 96% coverage: 1:242/253 of query aligns to 1:232/353 of 1oxvA
1oxuA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
31% identity, 96% coverage: 1:242/253 of query aligns to 1:232/353 of 1oxuA
Q97UY8 Glucose import ATP-binding protein GlcV; EC 7.5.2.- from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
31% identity, 96% coverage: 1:242/253 of query aligns to 1:232/353 of Q97UY8
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
30% identity, 99% coverage: 1:250/253 of query aligns to 4:230/353 of 1vciA
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
30% identity, 95% coverage: 3:243/253 of query aligns to 2:228/241 of 4u00A
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
28% identity, 99% coverage: 1:251/253 of query aligns to 4:245/375 of 2d62A
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
29% identity, 95% coverage: 3:243/253 of query aligns to 1:233/343 of P30750
Sites not aligning to the query:
>WP_011384082.1 NCBI__GCF_000009985.1:WP_011384082.1
MSLLKVEKLSKEFGGVHAVEDLTFSVEAGHIHSIIGPNGAGKTTLFNLITGVYTPSSGRV
LFQDRLVSGMKPYELAELGMSRTFQNLQIFFNMQAIENVMVGHHLHLDRRFLPSLLRLPK
VTRRDRECREYCAGLMEFVGLGKYLDADAASMPYGALKRLEIARALAAQPKLLLLDEPAA
GLNATESREIDEVIKKVATTGVTVVLVEHDMKMVMGISDQITALDYGRKLAEGTPAEVRA
NPEVVSAYLGTHG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory