Comparing WP_011384086.1 NCBI__GCF_000009985.1:WP_011384086.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
5c4iE Structure of an oxalate oxidoreductase (see paper)
49% identity, 81% coverage: 15:86/89 of query aligns to 236:307/312 of 5c4iE
5exdH Crystal structure of oxalate oxidoreductase from moorella thermoacetica bound with carboxy-di-oxido-methyl-tpp (coom-tpp) intermediate (see paper)
49% identity, 81% coverage: 15:86/89 of query aligns to 215:286/291 of 5exdH
7p63I Complex i from e. Coli, ddm/lmng-purified, under turnover at ph 6, closed state (see paper)
34% identity, 61% coverage: 35:88/89 of query aligns to 58:121/180 of 7p63I
Sites not aligning to the query:
>WP_011384086.1 NCBI__GCF_000009985.1:WP_011384086.1
MSLRNVPDNMCPIATEYTTMLTGDWRALRPIVDRDRCVKCATCWLYCPVQCVVEKAAWFD
FNYDYCKGCGICAEECPHRAIKMVEEAEG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory