SitesBLAST
Comparing WP_011384087.1 NCBI__GCF_000009985.1:WP_011384087.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 18 hits to proteins with known functional sites (download)
5exeA Crystal structure of oxalate oxidoreductase from moorella thermoacetica bound with carboxy-tpp adduct (see paper)
34% identity, 97% coverage: 7:399/405 of query aligns to 1:383/394 of 5exeA
5exdD Crystal structure of oxalate oxidoreductase from moorella thermoacetica bound with carboxy-di-oxido-methyl-tpp (coom-tpp) intermediate (see paper)
34% identity, 97% coverage: 7:399/405 of query aligns to 1:383/394 of 5exdD
- active site: R30 (≠ T36), E58 (= E64), R108 (= R114)
- binding [2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-4-methyl-2-[1,1,2-tris(oxidanyl)-2-oxidanylidene-ethyl]-1,3-thiazol-3-ium-5-yl]ethoxy-oxidanyl-phosphoryl] hydrogen phosphate: Y27 (= Y33), P28 (= P34), I29 (= I35), R30 (≠ T36), E58 (= E64), R108 (= R114), D115 (≠ C121)
5c4iA Structure of an oxalate oxidoreductase (see paper)
34% identity, 97% coverage: 7:399/405 of query aligns to 1:383/394 of 5c4iA
Q2RMD6 Pyruvate:ferredoxin oxidoreductase; PFOR; Pyruvate synthase; EC 1.2.7.1 from Moorella thermoacetica (strain ATCC 39073 / JCM 9320) (see paper)
27% identity, 83% coverage: 13:349/405 of query aligns to 7:342/1171 of Q2RMD6
Sites not aligning to the query:
- 424:428 binding
- 456 binding
- 556 binding
- 598 binding
- 686 binding
- 689 binding
- 692 binding
- 696 binding
- 742 binding
- 745 binding
- 748 binding
- 752 binding
- 809 binding
- 812 binding
- 814 binding
- 837 binding ; binding
- 967 binding
- 967:969 binding
- 995 binding
- 995:1000 binding
- 997 binding
- 1075 binding
6cioA Pyruvate:ferredoxin oxidoreductase from moorella thermoacetica with lactyl-tpp bound (see paper)
27% identity, 83% coverage: 13:349/405 of query aligns to 6:341/1164 of 6cioA
Sites not aligning to the query:
- active site: 999
- binding magnesium ion: 966, 994, 996
- binding iron/sulfur cluster: 455, 678, 680, 685, 686, 688, 689, 691, 695, 699, 700, 734, 741, 742, 744, 745, 747, 751, 757, 758, 807, 808, 811, 813, 836, 1074, 1075
- binding 3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-(1-carboxy-1-hydroxyethyl)-5-(2-{[hydroxy(phosphonooxy)phosphoryl]oxy}ethyl)-4-methyl-1,3-thiazol-3-ium: 813, 834, 835, 836, 865, 965, 966, 967, 996, 997, 998, 999, 1000
6cipA Pyruvate:ferredoxin oxidoreductase from moorella thermoacetica with acetyl-tpp bound (see paper)
27% identity, 83% coverage: 13:349/405 of query aligns to 6:341/1165 of 6cipA
Sites not aligning to the query:
- active site: 999
- binding 2-acetyl-thiamine diphosphate: 813, 834, 835, 836, 865, 965, 966, 967, 996, 998, 999
- binding magnesium ion: 966, 994, 996
- binding iron/sulfur cluster: 455, 678, 680, 685, 686, 688, 689, 691, 695, 699, 700, 734, 741, 742, 744, 745, 747, 751, 757, 758, 807, 808, 811, 813, 836, 998, 1074
6ciqA Pyruvate:ferredoxin oxidoreductase from moorella thermoacetica with coenzyme a bound (see paper)
27% identity, 83% coverage: 13:349/405 of query aligns to 6:341/1169 of 6ciqA
Sites not aligning to the query:
- active site: 999
- binding coenzyme a: 423, 424, 427, 428, 553, 586, 999
- binding magnesium ion: 966, 994, 996
- binding iron/sulfur cluster: 678, 680, 685, 686, 688, 689, 691, 695, 696, 700, 734, 741, 742, 743, 744, 745, 747, 751, 757, 807, 808, 811, 813, 836, 998, 1074, 1075
- binding thiamine diphosphate: 813, 835, 836, 865, 965, 966, 967, 996, 997, 998, 999, 1000
6cinB Crystal structure of pyruvate:ferredoxin oxidoreductase from moorella thermoacetica (see paper)
27% identity, 83% coverage: 13:349/405 of query aligns to 6:341/1169 of 6cinB
Sites not aligning to the query:
- active site: 999
- binding magnesium ion: 966, 994, 996
- binding iron/sulfur cluster: 455, 678, 685, 686, 687, 688, 689, 691, 695, 700, 741, 742, 743, 744, 745, 746, 747, 751, 752, 757, 758, 807, 808, 811, 813, 836, 998, 1074, 1075
- binding thiamine diphosphate: 834, 835, 836, 865, 965, 966, 967, 996, 997, 998, 999, 1000
7plmA Cryoem reconstruction of pyruvate ferredoxin oxidoreductase (pfor) in anaerobic conditions (see paper)
26% identity, 88% coverage: 8:363/405 of query aligns to 3:357/1177 of 7plmA
Sites not aligning to the query:
- binding calcium ion: 950, 952, 1026, 1028
- binding magnesium ion: 930, 958, 960, 962
- binding iron/sulfur cluster: 458, 657, 659, 664, 665, 666, 667, 668, 670, 674, 675, 679, 708, 715, 716, 717, 718, 719, 721, 725, 726, 731, 732, 781, 782, 785, 787, 810, 962, 1038, 1039
- binding thiamine diphosphate: 787, 808, 809, 810, 839, 929, 930, 931, 960, 961, 962, 963, 964
P94692 Pyruvate:ferredoxin oxidoreductase; PFOR; POR; Pyruvate synthase; EC 1.2.7.1 from Desulfocurvibacter africanus (Desulfovibrio africanus) (see 3 papers)
26% identity, 88% coverage: 8:363/405 of query aligns to 4:358/1232 of P94692
- T31 (= T36) binding
- E64 (= E64) binding
- R114 (= R114) binding
Sites not aligning to the query:
- 689 binding
- 692 binding
- 695 binding
- 699 binding
- 745 binding
- 748 binding
- 751 binding
- 755 binding
- 812 binding
- 815 binding
- 817 binding
- 840 binding ; binding
- 962:965 binding
- 963 binding
- 983 binding
- 985 binding
- 991 binding
- 991:996 binding
- 993 binding
- 1056 binding
- 1059 binding
- 1061 binding
- 1063 binding
- 1071 binding
2c3uA Crystal structure of pyruvate-ferredoxin oxidoreductase from desulfovibrio africanus, oxygen inhibited form (see paper)
26% identity, 88% coverage: 8:363/405 of query aligns to 3:357/1231 of 2c3uA
Sites not aligning to the query:
- active site: 995
- binding 2-(3-{[4-(hydroxyamino)-2-methylpyrimidin-5-yl]methyl}-4-methyl-2,3-dihydro-1,3-thiazol-5-yl)ethyl trihydrogen diphosphate: 816, 837, 839, 868, 869, 961, 962, 963, 964, 992, 993, 994, 995, 996
- binding calcium ion: 982, 984, 1055, 1056, 1058, 1060, 1062
- binding magnesium ion: 962, 990, 992
- binding pyruvic acid: 995
- binding iron/sulfur cluster: 458, 681, 683, 688, 689, 691, 692, 694, 698, 699, 702, 703, 744, 745, 746, 747, 748, 750, 754, 755, 760, 761, 811, 814, 816, 839, 1070, 1071
2c3pA Crystal structure of the free radical intermediate of pyruvate:ferredoxin oxidoreductase from desulfovibrio africanus (see paper)
26% identity, 88% coverage: 8:363/405 of query aligns to 3:357/1231 of 2c3pA
- active site: T30 (= T36), E63 (= E64), R113 (= R114)
- binding 1-(2-{(2s,4r,5r)-3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-[(1s)-1-carboxy-1-hydroxyethyl]-4-methyl-1,3-thiazolidin-5-yl}ethoxy)-1,1,3,3-tetrahydroxy-1lambda~5~-diphosphox-1-en-2-ium 3-oxide: P28 (= P34), I29 (= I35), T30 (= T36), E63 (= E64), Q87 (= Q88), R113 (= R114)
Sites not aligning to the query:
- active site: 995
- binding 1-(2-{(2s,4r,5r)-3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-[(1s)-1-carboxy-1-hydroxyethyl]-4-methyl-1,3-thiazolidin-5-yl}ethoxy)-1,1,3,3-tetrahydroxy-1lambda~5~-diphosphox-1-en-2-ium 3-oxide: 816, 837, 838, 839, 868, 869, 961, 962, 963, 992, 993, 994, 995, 996
- binding calcium ion: 982, 983, 984, 1055, 1056, 1058, 1060, 1062
- binding magnesium ion: 962, 990, 992
- binding iron/sulfur cluster: 458, 681, 683, 688, 689, 690, 691, 692, 694, 698, 699, 702, 703, 744, 745, 746, 747, 748, 750, 754, 755, 760, 761, 810, 811, 814, 816, 839, 994, 1070, 1071
2c3oA Crystal structure of the free radical intermediate of pyruvate:ferredoxin oxidoreductase from desulfovibrio africanus (see paper)
26% identity, 88% coverage: 8:363/405 of query aligns to 3:357/1231 of 2c3oA
Sites not aligning to the query:
- active site: 995
- binding calcium ion: 982, 984, 1056, 1058, 1060
- binding magnesium ion: 962, 990, 992
- binding pyruvic acid: 996
- binding iron/sulfur cluster: 458, 681, 688, 689, 691, 692, 694, 698, 699, 702, 703, 744, 746, 747, 748, 749, 750, 754, 760, 761, 810, 811, 814, 816, 839, 1070, 1071
- binding thiamine diphosphate: 816, 837, 838, 839, 868, 961, 962, 963, 992, 993, 994, 995, 996
1kekA Crystal structure of the free radical intermediate of pyruvate:ferredoxin oxidoreductase (see paper)
26% identity, 88% coverage: 8:363/405 of query aligns to 3:357/1231 of 1kekA
Sites not aligning to the query:
- active site: 995
- binding calcium ion: 982, 984, 1055, 1056, 1058, 1062
- binding 2-acetyl-thiamine diphosphate: 816, 837, 838, 839, 868, 961, 962, 963, 992, 993, 994, 995, 996
- binding magnesium ion: 962, 990, 992
- binding iron/sulfur cluster: 458, 681, 683, 688, 689, 690, 691, 692, 694, 698, 699, 703, 737, 744, 745, 746, 747, 748, 750, 754, 755, 760, 761, 810, 811, 814, 816, 839, 1070, 1071
1b0pA Crystal structure of pyruvate-ferredoxin oxidoreductase from desulfovibrio africanus (see paper)
26% identity, 88% coverage: 8:363/405 of query aligns to 3:357/1231 of 1b0pA
Sites not aligning to the query:
- active site: 995
- binding calcium ion: 982, 984, 1055, 1056, 1058, 1060
- binding magnesium ion: 962, 990, 992
- binding iron/sulfur cluster: 458, 681, 683, 688, 689, 690, 691, 692, 694, 698, 699, 702, 703, 737, 744, 745, 747, 748, 750, 754, 755, 760, 811, 814, 816, 839, 994, 1070, 1071
- binding thiamine diphosphate: 816, 837, 838, 839, 868, 961, 962, 963, 992, 993, 994, 995, 996
6n2oC 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus with 2-oxoglutarate, coenzyme a and succinyl-coa bound (see paper)
25% identity, 76% coverage: 9:317/405 of query aligns to 199:512/572 of 6n2oC
Sites not aligning to the query:
- binding succinyl-coenzyme a: 14, 16, 17, 18, 19, 41, 43, 44, 45, 128, 131, 157, 168
6n2oA 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus with 2-oxoglutarate, coenzyme a and succinyl-coa bound (see paper)
25% identity, 76% coverage: 9:317/405 of query aligns to 199:512/572 of 6n2oA
Sites not aligning to the query:
6n2nA Crystal structure of 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus (see paper)
25% identity, 76% coverage: 9:317/405 of query aligns to 199:512/572 of 6n2nA
Query Sequence
>WP_011384087.1 NCBI__GCF_000009985.1:WP_011384087.1
MNKVSTGKVIVCDGNEAAAWGACLSRPDMVAVYPITPQSSLVEYLAQFIADGRMDADLMD
VEGEHTVLSVLHGAVLAGARTYSATSAQGLAFMFEPYFRTPGLRLPMVVSLVTRDAVSPT
CVWGGQQDAMTVKEVGWIHMYCETQQEILDTIPIAYKVAEHPDVMLPVNVNHDGNYLSYG
VARVELPDQSVVDAFLGEKQVNWHACLDPERPMAVDPLTGGAGGIGPSLFVKYRKGICAG
MQDALRIIEEAHEDWGRRTGRYWSPLIEEYRMEDAEVALVTIGSMTGAAKDAVDDARASG
KKIGLVKIKTFRPFPAARIAQALSRVKAVGVVDRSVNFGWNCGPVYQEVLAAMYAQPVRI
PMMSFIGGLAGADITVEHFAEVVHRTFRLAGGEAATGPVWLNEND
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory