SitesBLAST
Comparing WP_011384088.1 NCBI__GCF_000009985.1:WP_011384088.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8c0zE Cryoem structure of a tungsten-containing aldehyde oxidoreductase from aromatoleum aromaticum (see paper)
31% identity, 96% coverage: 6:400/411 of query aligns to 2:407/424 of 8c0zE
6rvhA Nadh-dependent coenzyme a disulfide reductase soaked with menadione (see paper)
32% identity, 69% coverage: 27:311/411 of query aligns to 25:319/443 of 6rvhA
- active site: V39 (≠ L41), C44 (≠ T46), E53 (≠ R55), E58 (≠ D59), Y159 (≠ L155), E163 (≠ H159)
- binding coenzyme a: S40 (≠ P42), Y41 (= Y43), C44 (≠ T46), R63 (= R64), N303 (≠ V295), R307 (≠ K299)
- binding flavin-adenine dinucleotide: E34 (≠ T36), K35 (≠ R37), A43 (≠ P45), C44 (≠ T46), V81 (≠ A82), T113 (≠ S109), G114 (= G110), R134 (= R130), Y159 (≠ L155), G280 (= G272), D281 (= D273), P297 (≠ G289), L298 (≠ I290), G299 (≠ I291)
Sites not aligning to the query:
- active site: 425, 430
- binding coenzyme a: 20, 23, 359, 431, 437, 441, 442
- binding flavin-adenine dinucleotide: 8, 11, 12, 13, 424, 425
- binding menadione: 364, 365, 430, 431
6rvbA Nadh-dependent coenzyme a disulfide reductase soaked with nadh (see paper)
32% identity, 69% coverage: 27:311/411 of query aligns to 25:319/443 of 6rvbA
- active site: V39 (≠ L41), C44 (≠ T46), E53 (≠ R55), E58 (≠ D59), Y159 (≠ L155), E163 (≠ H159)
- binding coenzyme a: S40 (≠ P42), Y41 (= Y43), C44 (≠ T46), R63 (= R64), N303 (≠ V295), R307 (≠ K299)
- binding flavin-adenine dinucleotide: Y33 (≠ L35), E34 (≠ T36), K35 (≠ R37), S36 (≠ D38), A43 (≠ P45), C44 (≠ T46), E80 (≠ R81), V81 (≠ A82), T113 (≠ S109), G114 (= G110), L133 (= L129), R134 (= R130), I160 (≠ V156), G280 (= G272), D281 (= D273), L298 (≠ I290), G299 (≠ I291)
- binding nicotinamide-adenine-dinucleotide: G156 (= G152), G158 (= G154), Y159 (≠ L155), I160 (≠ V156), E179 (= E175), A180 (≠ M176), A240 (= A234), T241 (= T235), G242 (= G236), P297 (≠ G289)
Sites not aligning to the query:
- active site: 425, 430
- binding coenzyme a: 15, 20, 23, 359, 437, 441, 442
- binding flavin-adenine dinucleotide: 8, 11, 12, 13, 424, 425
- binding nicotinamide-adenine-dinucleotide: 328, 329
6ruzA Nadh-dependent coenzyme a disulfide reductase (see paper)
32% identity, 69% coverage: 27:311/411 of query aligns to 25:319/443 of 6ruzA
- active site: V39 (≠ L41), C44 (≠ T46), E53 (≠ R55), E58 (≠ D59), Y159 (≠ L155), E163 (≠ H159)
- binding coenzyme a: S40 (≠ P42), Y41 (= Y43), C44 (≠ T46), R63 (= R64), N303 (≠ V295), R307 (≠ K299)
- binding flavin-adenine dinucleotide: Y33 (≠ L35), E34 (≠ T36), K35 (≠ R37), A43 (≠ P45), C44 (≠ T46), E80 (≠ R81), V81 (≠ A82), T113 (≠ S109), G114 (= G110), A115 (= A111), L133 (= L129), R134 (= R130), Y159 (≠ L155), G280 (= G272), D281 (= D273), P297 (≠ G289), L298 (≠ I290), G299 (≠ I291)
Sites not aligning to the query:
- active site: 425, 430
- binding coenzyme a: 15, 19, 20, 23, 359, 441, 442
- binding flavin-adenine dinucleotide: 8, 11, 12, 13, 424, 425
5vn0A Water-forming nadh oxidase from lactobacillus brevis (lbnox) bound to nadh. (see paper)
26% identity, 95% coverage: 6:394/411 of query aligns to 3:403/449 of 5vn0A
- active site: H11 (= H14), I38 (≠ L41), L41 (≠ S44), S42 (≠ P45), C43 (≠ T46), Q75 (≠ V77), T102 (≠ V99), A277 (= A270), A282 (= A275), A283 (≠ Q276), V302 (= V295)
- binding flavin-adenine dinucleotide: G8 (= G11), T10 (≠ S13), H11 (= H14), A12 (= A15), E33 (≠ T36), R34 (= R37), N35 (≠ D38), S42 (≠ P45), C43 (≠ T46), N79 (≠ R81), V80 (≠ A82), T111 (≠ A108), S112 (= S109), G113 (= G110), K133 (≠ R130), G279 (= G272), D280 (= D273), L297 (≠ I290), A298 (≠ I291)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G157 (= G154), Y158 (≠ L155), I159 (≠ V156), E162 (≠ H159), D178 (≠ E175), A179 (≠ M176), K186 (≠ G183), Y187 (= Y184), I241 (≠ T235), G242 (= G236), F243 (≠ V237), P296 (≠ G289), L297 (≠ I290)
Sites not aligning to the query:
5er0A Water-forming nadh oxidase from lactobacillus brevis (lbnox) (see paper)
26% identity, 95% coverage: 6:394/411 of query aligns to 3:403/450 of 5er0A
- active site: H11 (= H14), I38 (≠ L41), L41 (≠ S44), S42 (≠ P45), C43 (≠ T46), Q75 (≠ V77), T102 (≠ V99), A277 (= A270), A282 (= A275), A283 (≠ Q276), V302 (= V295)
- binding flavin-adenine dinucleotide: G8 (= G11), T10 (≠ S13), H11 (= H14), A12 (= A15), E33 (≠ T36), R34 (= R37), S42 (≠ P45), C43 (≠ T46), N79 (≠ R81), V80 (≠ A82), S112 (= S109), G113 (= G110), K133 (≠ R130), Y158 (≠ L155), I159 (≠ V156), N246 (≠ V240), G279 (= G272), D280 (= D273), P296 (≠ G289), L297 (≠ I290), A298 (≠ I291)
Sites not aligning to the query:
5vohA Crystal structure of engineered water-forming NADPH oxidase (tpnox) bound to NADPH. The g159a, d177a, a178r, m179s, p184r mutant of lbnox. (see paper)
26% identity, 93% coverage: 6:389/411 of query aligns to 2:397/448 of 5vohA
- active site: H10 (= H14), I37 (≠ L41), L40 (≠ S44), S41 (≠ P45), C42 (≠ T46), Q74 (≠ V77), T101 (≠ V99), A276 (= A270), A281 (= A275), A282 (≠ Q276), V301 (= V295)
- binding flavin-adenine dinucleotide: G7 (= G11), T9 (≠ S13), H10 (= H14), A11 (= A15), E32 (≠ T36), R33 (= R37), N34 (≠ D38), S41 (≠ P45), C42 (≠ T46), N78 (≠ R81), V79 (≠ A82), T110 (≠ A108), S111 (= S109), G112 (= G110), K132 (≠ R130), I158 (≠ V156), F242 (≠ V237), N245 (≠ V240), G278 (= G272), D279 (= D273), P295 (≠ G289), L296 (≠ I290), A297 (≠ I291), A300 (= A294)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: A155 (= A153), G156 (= G154), Y157 (≠ L155), I158 (≠ V156), R178 (≠ M176), S179 (≠ Q177), R184 (≠ P182), K185 (≠ G183), Y186 (= Y184), I240 (≠ T235), F242 (≠ V237), P295 (≠ G289), L296 (≠ I290)
Sites not aligning to the query:
8a56B Coenzyme a-persulfide reductase (coapr) from enterococcus faecalis (see paper)
29% identity, 82% coverage: 6:342/411 of query aligns to 2:349/539 of 8a56B
- binding flavin-adenine dinucleotide: I6 (≠ V10), G7 (= G11), V9 (≠ S13), G11 (≠ A15), E32 (≠ T36), K33 (≠ R37), C42 (≠ T46), V80 (≠ A82), S109 (≠ A108), P110 (≠ S109), G111 (= G110), I159 (≠ V156), G278 (= G272), D279 (= D273), S295 (≠ G289), L296 (≠ I290), A297 (≠ I291)
- binding 3'-phosphate-adenosine-5'-diphosphate: T17 (≠ R21), R18 (≠ A22), R21 (≠ L25), F70 (≠ N72), R305 (≠ K299)
Sites not aligning to the query:
3cgeA Pyridine nucleotide complexes with bacillus anthracis coenzyme a- disulfide reductase: a structural analysis of dual NAD(p)h specificity (see paper)
27% identity, 90% coverage: 7:377/411 of query aligns to 3:379/444 of 3cgeA
- active site: A10 (≠ H14), Y37 (≠ L41), Q41 (≠ P45), C42 (≠ T46), N304 (≠ V295)
- binding coenzyme a: M17 (≠ R21), R21 (≠ L25), S38 (≠ P42), C42 (≠ T46), R61 (= R64), N304 (≠ V295), R308 (≠ K299)
- binding flavin-adenine dinucleotide: I6 (≠ V10), D9 (≠ S13), A10 (≠ H14), A11 (= A15), L31 (= L35), E32 (≠ T36), K33 (≠ R37), Q41 (≠ P45), C42 (≠ T46), V80 (vs. gap), T112 (≠ S109), G113 (= G110), G281 (= G272), D282 (= D273), I299 (= I290), G300 (≠ I291), A303 (= A294)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: I156 (≠ L151), G157 (= G152), A160 (≠ L155), I161 (≠ V156), E164 (≠ H159), E180 (= E175), R181 (≠ M176), N182 (≠ Q177), T187 (≠ P182), V242 (≠ T235), G243 (= G236), P298 (≠ G289), I299 (= I290)
Sites not aligning to the query:
3cgdA Pyridine nucleotide complexes with bacillus anthracis coenzyme a- disulfide reductase: a structural analysis of dual NAD(p)h specificity (see paper)
27% identity, 90% coverage: 7:377/411 of query aligns to 3:379/444 of 3cgdA
- active site: A10 (≠ H14), Y37 (≠ L41), Q41 (≠ P45), C42 (≠ T46), N304 (≠ V295)
- binding coenzyme a: M17 (≠ R21), Q18 (≠ A22), R21 (≠ L25), S38 (≠ P42), Y39 (= Y43), C42 (≠ T46), R61 (= R64), N304 (≠ V295), R308 (≠ K299)
- binding flavin-adenine dinucleotide: I6 (≠ V10), G7 (= G11), D9 (≠ S13), A10 (≠ H14), A11 (= A15), L31 (= L35), E32 (≠ T36), K33 (≠ R37), Q41 (≠ P45), C42 (≠ T46), V80 (vs. gap), A111 (= A108), T112 (≠ S109), G281 (= G272), D282 (= D273), I299 (= I290), G300 (≠ I291), A303 (= A294)
- binding nicotinamide-adenine-dinucleotide: I156 (≠ L151), G157 (= G152), G159 (= G154), A160 (≠ L155), I161 (≠ V156), E164 (≠ H159), E180 (= E175), R181 (≠ M176), V242 (≠ T235), G243 (= G236), P298 (≠ G289), I299 (= I290)
Sites not aligning to the query:
3cgbA Pyridine nucleotide complexes with bacillus anthracis coenzyme a- disulfide reductase: a structural analysis of dual NAD(p)h specificity (see paper)
27% identity, 90% coverage: 7:377/411 of query aligns to 3:379/444 of 3cgbA
- active site: A10 (≠ H14), Y37 (≠ L41), Q41 (≠ P45), C42 (≠ T46), N304 (≠ V295)
- binding coenzyme a: D9 (≠ S13), A10 (≠ H14), M17 (≠ R21), R21 (≠ L25), S38 (≠ P42), Y39 (= Y43), C42 (≠ T46), R61 (= R64), N304 (≠ V295), R308 (≠ K299)
- binding flavin-adenine dinucleotide: I6 (≠ V10), G7 (= G11), D9 (≠ S13), A10 (≠ H14), A11 (= A15), E32 (≠ T36), K33 (≠ R37), Q41 (≠ P45), C42 (≠ T46), V80 (vs. gap), T112 (≠ S109), L132 (= L129), I161 (≠ V156), G281 (= G272), D282 (= D273), I299 (= I290), G300 (≠ I291), A303 (= A294)
Sites not aligning to the query:
6pfzA Structure of a NAD-dependent persulfide reductase from a. Fulgidus (see paper)
28% identity, 76% coverage: 23:334/411 of query aligns to 19:346/541 of 6pfzA
- active site: V37 (≠ L41), C42 (≠ T46)
- binding calcium ion: D306 (≠ P292), T332 (≠ V320)
- binding coenzyme a: R21 (≠ L25), S38 (≠ P42), G40 (≠ S44), C42 (≠ T46), K76 (≠ N72), R313 (≠ K299)
- binding flavin-adenine dinucleotide: E32 (≠ T36), A33 (≠ R37), R41 (≠ P45), C42 (≠ T46), A86 (= A82), A115 (= A108), T116 (≠ S109), G117 (= G110), L136 (= L129), G286 (= G272), D287 (= D273), P303 (≠ G289), F304 (≠ I290), G305 (≠ I291)
Sites not aligning to the query:
2cduA The crystal structure of water-forming NAD(p)h oxidase from lactobacillus sanfranciscensis (see paper)
24% identity, 80% coverage: 6:334/411 of query aligns to 2:341/451 of 2cduA
- active site: H10 (= H14), I37 (≠ L41), S41 (= S44), C42 (≠ P45), V304 (= V295)
- binding adenosine-5'-diphosphate: G158 (= G154), I160 (≠ V156), D179 (≠ E175), G180 (≠ M176), H181 (≠ Q177), Y188 (= Y184), K213 (= K209), V214 (= V210), I243 (≠ T235), G244 (= G236)
- binding flavin-adenine dinucleotide: G7 (= G11), T9 (≠ S13), H10 (= H14), A11 (= A15), E32 (≠ T36), M33 (≠ R37), S41 (= S44), C42 (≠ P45), V81 (≠ A82), T112 (≠ A108), T113 (≠ S109), G114 (= G110), K134 (≠ R130), I160 (≠ V156), G281 (= G272), D282 (= D273), P298 (≠ G289), L299 (≠ I290), A300 (≠ I291)
Sites not aligning to the query:
3nt6A Structure of the shewanella loihica pv-4 nadh-dependent persulfide reductase c43s/c531s double mutant (see paper)
29% identity, 68% coverage: 34:311/411 of query aligns to 31:341/565 of 3nt6A
- active site: V38 (≠ L41), N42 (≠ P45), S43 (≠ T46), N325 (≠ V295)
- binding coenzyme a: S39 (≠ P42), N42 (≠ P45), S43 (≠ T46), A321 (≠ I291), N325 (≠ V295), R329 (≠ K299)
- binding flavin-adenine dinucleotide: E33 (≠ T36), R34 (= R37), N42 (≠ P45), S43 (≠ T46), E80 (≠ R81), V81 (≠ A82), S112 (≠ A108), P113 (≠ S109), G114 (= G110), L133 (= L129), R134 (= R130), F161 (≠ L155), G302 (= G272), D303 (= D273), P319 (≠ G289), L320 (≠ I290), A321 (≠ I291)
Sites not aligning to the query:
- active site: 11, 471, 472
- binding coenzyme a: 11, 18, 19, 22, 459, 462, 463, 466, 534, 535
- binding flavin-adenine dinucleotide: 7, 8, 10, 11, 12
3fg2P Crystal structure of ferredoxin reductase for the cyp199a2 system from rhodopseudomonas palustris (see paper)
28% identity, 75% coverage: 8:316/411 of query aligns to 5:316/404 of 3fg2P
- binding flavin-adenine dinucleotide: G8 (= G11), G10 (≠ S13), H11 (= H14), A12 (= A15), D34 (≠ R37), E35 (≠ D38), R42 (vs. gap), P43 (vs. gap), S46 (≠ I47), K47 (≠ L48), R78 (= R81), M79 (≠ A82), T106 (≠ S109), R127 (= R130), I153 (≠ V156), D275 (= D273), S292 (≠ I290), V293 (≠ I291)
Sites not aligning to the query:
P16640 Putidaredoxin reductase CamA; Pdr; Putidaredoxin--NAD(+) reductase; EC 1.18.1.5 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
23% identity, 94% coverage: 1:385/411 of query aligns to 1:394/422 of P16640
- A15 (= A15) binding
- D37 (≠ R37) binding
- K50 (≠ P49) binding
- V83 (≠ A82) binding
- R134 (= R130) binding
- D284 (= D273) binding
- V302 (≠ I291) binding
1q1wA Crystal structure of putidaredoxin reductase from pseudomonas putida (see paper)
23% identity, 92% coverage: 8:385/411 of query aligns to 7:393/422 of 1q1wA
- active site: L13 (≠ H14), L44 (vs. gap), P45 (= P45), L305 (≠ V295)
- binding flavin-adenine dinucleotide: G10 (= G11), G12 (≠ S13), L13 (≠ H14), A14 (= A15), G35 (≠ T36), D36 (≠ R37), L44 (vs. gap), P45 (= P45), K49 (≠ P49), V82 (≠ A82), A108 (= A108), T109 (≠ S109), G110 (= G110), R133 (= R130), I159 (≠ V156), D283 (= D273), S300 (≠ I290), V301 (≠ I291), W329 (≠ P319)
Q9HTK9 Rubredoxin-NAD(+) reductase; RdxR; EC 1.18.1.1 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
27% identity, 78% coverage: 1:321/411 of query aligns to 1:318/384 of Q9HTK9
Sites not aligning to the query:
2v3aA Crystal structure of rubredoxin reductase from pseudomonas aeruginosa. (see paper)
27% identity, 77% coverage: 5:321/411 of query aligns to 2:315/381 of 2v3aA
- active site: L11 (≠ H14), K42 (≠ P45), P43 (≠ T46), M290 (≠ A294)
- binding flavin-adenine dinucleotide: I7 (≠ V10), G8 (= G11), T9 (≠ S12), G10 (≠ S13), A12 (= A15), T33 (= T36), A34 (≠ R37), D35 (= D38), K42 (≠ P45), P43 (≠ T46), R79 (= R81), V80 (≠ A82), A105 (= A108), W106 (≠ S109), G107 (= G110), I153 (≠ V156), F157 (≠ A160), D274 (= D273), L284 (≠ I288), Y285 (≠ G289), V286 (≠ I290)
Sites not aligning to the query:
2yvjA Crystal structure of the ferredoxin-ferredoxin reductase (bpha3-bpha4)complex (see paper)
33% identity, 53% coverage: 82:298/411 of query aligns to 78:294/402 of 2yvjA
- active site: Q291 (≠ V295)
- binding flavin-adenine dinucleotide: A78 (= A82), T105 (≠ S109), G106 (= G110), R126 (= R130), G268 (= G272), D269 (= D273), T286 (≠ I290), W287 (≠ I291), A290 (= A294)
- binding 1,4-dihydronicotinamide adenine dinucleotide: V147 (≠ L151), G148 (= G152), G149 (≠ A153), G150 (= G154), I152 (≠ V156), V170 (= V174), E171 (= E175), T172 (≠ M176), R179 (≠ G183), G230 (≠ A234), I231 (≠ T235), G232 (= G236), V233 (= V237), E285 (≠ G289)
Sites not aligning to the query:
Query Sequence
>WP_011384088.1 NCBI__GCF_000009985.1:WP_011384088.1
MMPEAKYLLVGSSHAALEALRAIRLVDPDGSMAMLTRDDRLPYSPTILPYVVSGRSAPDK
VLLRDPAFFAANNCAYVPNARAVSLDAKARAVTLENGEVWRYQSLLIASGAAPAIPPVKG
LDGVTYHVLRSLADAEGLRGAMGAAKTAVVLGAGLVGLHAAENMAEAGLKVTVVEMQGHV
LPGYFDAKASTRIEDAFTTHGVELKLGRKVVEVAPGKVMVDDGTTIAADLLLVATGVRPV
TDWLEGSGVLVDRGVVVDEAMRTNIDGVWAAGDVAQATDFASGNKALIGIIPTAVEQGKI
AGQGMAGDSYRKDYAGGLPVNTYRFFGRVALSIGRAAATDGVEAVETASGAYRRLVLEGN
RLVGYASVDEPFDVGIMGELIRRRVDLSECKDAFLARPVETGRRLMSEQWR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory