SitesBLAST
Comparing WP_011384089.1 NCBI__GCF_000009985.1:WP_011384089.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5exeC Crystal structure of oxalate oxidoreductase from moorella thermoacetica bound with carboxy-tpp adduct (see paper)
38% identity, 61% coverage: 145:428/469 of query aligns to 14:301/314 of 5exeC
- active site: N143 (= N270)
- binding [2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-carboxy-4-methyl-1,3-thiazol-3-ium-5-yl]ethoxy-oxidanyl-phosphoryl] hydrogen phosphate: T50 (≠ P181), G51 (= G182), C52 (= C183), I74 (≠ L207), G109 (= G236), D110 (= D237), G111 (= G238), Y136 (≠ V263), N138 (= N265), S140 (≠ G267), Y141 (= Y268), A142 (≠ M269), N143 (= N270), T144 (= T271)
- binding magnesium ion: D110 (= D237), D130 (≠ K257), N138 (= N265), S140 (≠ G267), L211 (≠ I335), Q213 (≠ F339)
- binding iron/sulfur cluster: C24 (= C155), C27 (= C158), P29 (≠ S160), C52 (= C183), C225 (= C351), P226 (= P352), K227 (≠ T353)
5c4iC Structure of an oxalate oxidoreductase (see paper)
38% identity, 61% coverage: 145:428/469 of query aligns to 14:301/312 of 5c4iC
- active site: N143 (= N270)
- binding magnesium ion: D110 (= D237), N138 (= N265), S140 (≠ G267)
- binding iron/sulfur cluster: C24 (= C155), C27 (= C158), P29 (≠ S160), C52 (= C183), A142 (≠ M269), C225 (= C351), P226 (= P352), K227 (≠ T353)
- binding thiamine diphosphate: T50 (≠ P181), G51 (= G182), C52 (= C183), I74 (≠ L207), G109 (= G236), D110 (= D237), G111 (= G238), Y136 (≠ V263), N138 (= N265), S140 (≠ G267), Y141 (= Y268), A142 (≠ M269), N143 (= N270), T144 (= T271)
5exdF Crystal structure of oxalate oxidoreductase from moorella thermoacetica bound with carboxy-di-oxido-methyl-tpp (coom-tpp) intermediate (see paper)
38% identity, 61% coverage: 145:428/469 of query aligns to 14:301/310 of 5exdF
- active site: N143 (= N270)
- binding magnesium ion: D110 (= D237), N138 (= N265), S140 (≠ G267)
- binding [2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-4-methyl-2-[1,1,2-tris(oxidanyl)-2-oxidanylidene-ethyl]-1,3-thiazol-3-ium-5-yl]ethoxy-oxidanyl-phosphoryl] hydrogen phosphate: T50 (≠ P181), G51 (= G182), C52 (= C183), I74 (≠ L207), D110 (= D237), G111 (= G238), Y136 (≠ V263), N138 (= N265), S140 (≠ G267), Y141 (= Y268), A142 (≠ M269), N143 (= N270), T144 (= T271)
- binding iron/sulfur cluster: C24 (= C155), C27 (= C158), P29 (≠ S160), C52 (= C183), A142 (≠ M269), C225 (= C351), K227 (≠ T353)
8c0zC Cryoem structure of a tungsten-containing aldehyde oxidoreductase from aromatoleum aromaticum (see paper)
34% identity, 28% coverage: 5:134/469 of query aligns to 2:136/158 of 8c0zC
- binding iron/sulfur cluster: C12 (= C15), T13 (≠ D16), C15 (= C18), C18 (= C21), C22 (= C25), C53 (= C51), C56 (= C54), C61 (= C59), C65 (= C63), I70 (≠ L68), C86 (= C84), C89 (= C87), C92 (= C90), C96 (= C94), T100 (≠ G98), K112 (= K110), C113 (= C111), C116 (= C114), C122 (= C120), C126 (= C124), T128 (= T126)
P0AAJ3 Formate dehydrogenase, nitrate-inducible, iron-sulfur subunit; Anaerobic formate dehydrogenase iron-sulfur subunit; Formate dehydrogenase-N subunit beta; FDH-N subunit beta from Escherichia coli (strain K12) (see paper)
29% identity, 26% coverage: 10:131/469 of query aligns to 34:186/294 of P0AAJ3
- C39 (= C15) binding
- C42 (= C18) binding
- C45 (= C21) binding
- C49 (= C25) binding
- C100 (= C51) binding
- C103 (= C54) binding
- C108 (= C59) binding
- C112 (= C63) binding
- C133 (= C84) binding
- C136 (= C87) binding
- C139 (= C90) binding
- C143 (= C94) binding
- C160 (= C111) binding
- C163 (= C114) binding
- C175 (= C120) binding
- C179 (= C124) binding
1kqfB Formate dehydrogenase n from e. Coli (see paper)
29% identity, 26% coverage: 10:131/469 of query aligns to 33:185/289 of 1kqfB
- binding protoporphyrin ix containing fe: Y137 (≠ L89)
- binding iron/sulfur cluster: C38 (= C15), I39 (≠ D16), G40 (= G17), C41 (= C18), K42 (≠ G19), C44 (= C21), C48 (= C25), N52 (≠ K29), T77 (vs. gap), M79 (vs. gap), C99 (= C51), M100 (≠ R52), H101 (≠ Q53), C102 (= C54), P105 (= P57), C107 (= C59), C111 (= C63), P112 (= P64), I117 (≠ D69), V125 (≠ I77), C132 (= C84), I133 (≠ V85), G134 (≠ D86), C135 (= C87), G136 (≠ L88), Y137 (≠ L89), C138 (= C90), C142 (= C94), I146 (≠ G98), P147 (≠ I99), V156 (= V108), K158 (= K110), C159 (= C111), L161 (≠ Q113), C162 (= C114), P172 (= P118), C174 (= C120), C178 (= C124), P179 (= P125), I183 (≠ L129)
Sites not aligning to the query:
P18776 Anaerobic dimethyl sulfoxide reductase chain B; DMSO reductase iron-sulfur subunit from Escherichia coli (strain K12) (see 2 papers)
29% identity, 28% coverage: 12:142/469 of query aligns to 11:163/205 of P18776
- C102 (= C87) mutation C->F,S,W,Y: Loss of electron transfer from menaquinol to DMSO.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
7plmA Cryoem reconstruction of pyruvate ferredoxin oxidoreductase (pfor) in anaerobic conditions (see paper)
28% identity, 44% coverage: 231:435/469 of query aligns to 924:1129/1177 of 7plmA
- binding calcium ion: D950 (≠ K257), N952 (≠ L259), F1026 (= F339), G1028 (= G341)
- binding magnesium ion: D930 (= D237), T958 (≠ N265), V960 (≠ G267), S962 (≠ M269)
- binding iron/sulfur cluster: S962 (≠ M269), C1038 (= C351), I1039 (≠ P352)
- binding thiamine diphosphate: G929 (= G236), D930 (= D237), G931 (= G238), V960 (≠ G267), Y961 (= Y268), S962 (≠ M269), N963 (= N270), T964 (= T271)
Sites not aligning to the query:
- binding iron/sulfur cluster: 458, 657, 659, 664, 665, 666, 667, 668, 670, 674, 675, 679, 708, 715, 716, 717, 718, 719, 721, 725, 726, 731, 732, 781, 782, 785, 787, 810
- binding thiamine diphosphate: 27, 28, 29, 63, 787, 808, 809, 810, 839
2c3uA Crystal structure of pyruvate-ferredoxin oxidoreductase from desulfovibrio africanus, oxygen inhibited form (see paper)
32% identity, 32% coverage: 231:380/469 of query aligns to 956:1100/1231 of 2c3uA
- active site: N995 (= N270)
- binding 2-(3-{[4-(hydroxyamino)-2-methylpyrimidin-5-yl]methyl}-4-methyl-2,3-dihydro-1,3-thiazol-5-yl)ethyl trihydrogen diphosphate: G961 (= G236), D962 (= D237), G963 (= G238), W964 (≠ G239), V992 (≠ G267), Y993 (= Y268), S994 (≠ M269), N995 (= N270), T996 (= T271)
- binding calcium ion: D982 (≠ K257), N984 (≠ L259), A1055 (= A336), E1056 (≠ A337), F1058 (= F339), G1060 (= G341), S1062 (= S343)
- binding magnesium ion: D962 (= D237), T990 (≠ N265), V992 (≠ G267)
- binding pyruvic acid: N995 (= N270)
- binding iron/sulfur cluster: C1070 (= C351), I1071 (≠ P352)
Sites not aligning to the query:
- active site: 30, 63, 113
- binding 2-(3-{[4-(hydroxyamino)-2-methylpyrimidin-5-yl]methyl}-4-methyl-2,3-dihydro-1,3-thiazol-5-yl)ethyl trihydrogen diphosphate: 28, 29, 63, 87, 816, 837, 839, 868, 869
- binding pyruvic acid: 30, 113, 122
- binding iron/sulfur cluster: 458, 681, 683, 688, 689, 691, 692, 694, 698, 699, 702, 703, 744, 745, 746, 747, 748, 750, 754, 755, 760, 761, 811, 814, 816, 839
2c3pA Crystal structure of the free radical intermediate of pyruvate:ferredoxin oxidoreductase from desulfovibrio africanus (see paper)
32% identity, 32% coverage: 231:380/469 of query aligns to 956:1100/1231 of 2c3pA
- active site: N995 (= N270)
- binding 1-(2-{(2s,4r,5r)-3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-[(1s)-1-carboxy-1-hydroxyethyl]-4-methyl-1,3-thiazolidin-5-yl}ethoxy)-1,1,3,3-tetrahydroxy-1lambda~5~-diphosphox-1-en-2-ium 3-oxide: G961 (= G236), D962 (= D237), G963 (= G238), V992 (≠ G267), Y993 (= Y268), S994 (≠ M269), N995 (= N270), T996 (= T271)
- binding calcium ion: D982 (≠ K257), V983 (= V258), N984 (≠ L259), A1055 (= A336), E1056 (≠ A337), F1058 (= F339), G1060 (= G341), S1062 (= S343)
- binding magnesium ion: D962 (= D237), T990 (≠ N265), V992 (≠ G267)
- binding iron/sulfur cluster: S994 (≠ M269), C1070 (= C351), I1071 (≠ P352)
Sites not aligning to the query:
- active site: 30, 63, 113
- binding 1-(2-{(2s,4r,5r)-3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-[(1s)-1-carboxy-1-hydroxyethyl]-4-methyl-1,3-thiazolidin-5-yl}ethoxy)-1,1,3,3-tetrahydroxy-1lambda~5~-diphosphox-1-en-2-ium 3-oxide: 28, 29, 30, 63, 87, 113, 816, 837, 838, 839, 868, 869
- binding iron/sulfur cluster: 458, 681, 683, 688, 689, 690, 691, 692, 694, 698, 699, 702, 703, 744, 745, 746, 747, 748, 750, 754, 755, 760, 761, 810, 811, 814, 816, 839
2c3oA Crystal structure of the free radical intermediate of pyruvate:ferredoxin oxidoreductase from desulfovibrio africanus (see paper)
32% identity, 32% coverage: 231:380/469 of query aligns to 956:1100/1231 of 2c3oA
- active site: N995 (= N270)
- binding calcium ion: D982 (≠ K257), N984 (≠ L259), E1056 (≠ A337), F1058 (= F339), G1060 (= G341)
- binding magnesium ion: D962 (= D237), T990 (≠ N265), V992 (≠ G267)
- binding pyruvic acid: T996 (= T271)
- binding iron/sulfur cluster: C1070 (= C351), I1071 (≠ P352)
- binding thiamine diphosphate: G961 (= G236), D962 (= D237), G963 (= G238), V992 (≠ G267), Y993 (= Y268), S994 (≠ M269), N995 (= N270), T996 (= T271)
Sites not aligning to the query:
- active site: 30, 63, 113
- binding pyruvic acid: 30, 113
- binding iron/sulfur cluster: 458, 681, 688, 689, 691, 692, 694, 698, 699, 702, 703, 744, 746, 747, 748, 749, 750, 754, 760, 761, 810, 811, 814, 816, 839
- binding thiamine diphosphate: 28, 29, 63, 87, 816, 837, 838, 839, 868
1kekA Crystal structure of the free radical intermediate of pyruvate:ferredoxin oxidoreductase (see paper)
32% identity, 32% coverage: 231:380/469 of query aligns to 956:1100/1231 of 1kekA
- active site: N995 (= N270)
- binding calcium ion: D982 (≠ K257), N984 (≠ L259), A1055 (= A336), E1056 (≠ A337), F1058 (= F339), S1062 (= S343)
- binding 2-acetyl-thiamine diphosphate: G961 (= G236), D962 (= D237), G963 (= G238), V992 (≠ G267), Y993 (= Y268), S994 (≠ M269), N995 (= N270), T996 (= T271)
- binding magnesium ion: D962 (= D237), T990 (≠ N265), V992 (≠ G267)
- binding iron/sulfur cluster: C1070 (= C351), I1071 (≠ P352)
Sites not aligning to the query:
- active site: 30, 63, 113
- binding 2-acetyl-thiamine diphosphate: 29, 63, 87, 113, 816, 837, 838, 839, 868
- binding iron/sulfur cluster: 458, 681, 683, 688, 689, 690, 691, 692, 694, 698, 699, 703, 737, 744, 745, 746, 747, 748, 750, 754, 755, 760, 761, 810, 811, 814, 816, 839
1b0pA Crystal structure of pyruvate-ferredoxin oxidoreductase from desulfovibrio africanus (see paper)
32% identity, 32% coverage: 231:380/469 of query aligns to 956:1100/1231 of 1b0pA
- active site: N995 (= N270)
- binding calcium ion: D982 (≠ K257), N984 (≠ L259), A1055 (= A336), E1056 (≠ A337), F1058 (= F339), G1060 (= G341)
- binding magnesium ion: D962 (= D237), T990 (≠ N265), V992 (≠ G267)
- binding iron/sulfur cluster: S994 (≠ M269), C1070 (= C351), I1071 (≠ P352)
- binding thiamine diphosphate: G961 (= G236), D962 (= D237), G963 (= G238), V992 (≠ G267), Y993 (= Y268), S994 (≠ M269), N995 (= N270), T996 (= T271)
Sites not aligning to the query:
- active site: 30, 63, 113
- binding iron/sulfur cluster: 458, 681, 683, 688, 689, 690, 691, 692, 694, 698, 699, 702, 703, 737, 744, 745, 747, 748, 750, 754, 755, 760, 811, 814, 816, 839
- binding thiamine diphosphate: 28, 29, 63, 816, 837, 838, 839, 868
P94692 Pyruvate:ferredoxin oxidoreductase; PFOR; POR; Pyruvate synthase; EC 1.2.7.1 from Desulfocurvibacter africanus (Desulfovibrio africanus) (see 3 papers)
30% identity, 36% coverage: 213:380/469 of query aligns to 941:1101/1232 of P94692
Sites not aligning to the query:
- 31 binding
- 64 binding
- 114 binding
- 689 binding
- 692 binding
- 695 binding
- 699 binding
- 745 binding
- 748 binding
- 751 binding
- 755 binding
- 812 binding
- 815 binding
- 817 binding
- 840 binding ; binding
7qv7A Cryo-em structure of hydrogen-dependent co2 reductase. (see paper)
29% identity, 29% coverage: 15:152/469 of query aligns to 12:169/174 of 7qv7A
- binding iron/sulfur cluster: C12 (= C15), L13 (≠ D16), G14 (= G17), C15 (= C18), Y16 (≠ G19), C18 (= C21), C22 (= C25), H26 (vs. gap), L37 (≠ I37), C51 (= C51), R52 (= R52), C54 (= C54), C59 (= C59), C63 (= C63), C82 (= C84), I83 (≠ V85), G84 (≠ D86), C85 (= C87), C88 (= C90), C92 (= C94), I97 (= I99), F99 (vs. gap), C125 (= C111), L127 (≠ Q113), C128 (= C114), A136 (= A119), C137 (= C120), C141 (= C124)
6n2oD 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus with 2-oxoglutarate, coenzyme a and succinyl-coa bound (see paper)
27% identity, 49% coverage: 155:386/469 of query aligns to 25:236/291 of 6n2oD
- binding magnesium ion: D101 (= D237), N129 (= N265), I131 (≠ G267)
- binding succinyl-coenzyme a: I57 (≠ M187), R62 (≠ K199), L134 (≠ N270), K136 (≠ G272)
- binding iron/sulfur cluster: C25 (= C155), C28 (= C158), C59 (≠ S189), C208 (= C351), T210 (= T353), F211 (≠ G354)
- binding thiamine diphosphate: I57 (≠ M187), G58 (= G188), C59 (≠ S189), S60 (≠ G197), H76 (≠ L207), G102 (= G238), D103 (≠ G239), N129 (= N265), I131 (≠ G267), G133 (≠ M269), L134 (≠ N270), T135 (= T271)
Sites not aligning to the query:
6n2oB 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus with 2-oxoglutarate, coenzyme a and succinyl-coa bound (see paper)
27% identity, 49% coverage: 155:386/469 of query aligns to 25:236/291 of 6n2oB
- binding 2-oxoglutaric acid: R62 (≠ K199), L134 (≠ N270)
- binding coenzyme a: K136 (≠ G272), Y150 (≠ S286)
- binding magnesium ion: D101 (= D237), N129 (= N265), I131 (≠ G267)
- binding iron/sulfur cluster: C25 (= C155), C28 (= C158), C59 (≠ S189), C208 (= C351), T210 (= T353), F211 (≠ G354)
- binding thiamine diphosphate: I57 (≠ M187), G58 (= G188), C59 (≠ S189), S60 (≠ G197), H76 (≠ L207), G102 (= G238), D103 (≠ G239), N129 (= N265), I131 (≠ G267), Y132 (= Y268), G133 (≠ M269), L134 (≠ N270), T135 (= T271)
Sites not aligning to the query:
6n2nB Crystal structure of 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus (see paper)
27% identity, 49% coverage: 155:386/469 of query aligns to 25:236/291 of 6n2nB
- binding magnesium ion: D101 (= D237), N129 (= N265), I131 (≠ G267)
- binding iron/sulfur cluster: C25 (= C155), C28 (= C158), H30 (≠ S160), C59 (≠ S189), C208 (= C351), T210 (= T353), F211 (≠ G354)
- binding thiamine diphosphate: I57 (≠ M187), G58 (= G188), C59 (≠ S189), S60 (≠ G197), H76 (≠ L207), G100 (= G236), D101 (= D237), G102 (= G238), D103 (≠ G239), N129 (= N265), I131 (≠ G267), Y132 (= Y268), G133 (≠ M269), L134 (≠ N270), T135 (= T271)
Sites not aligning to the query:
7qv7B Cryo-em structure of hydrogen-dependent co2 reductase. (see paper)
31% identity, 25% coverage: 15:131/469 of query aligns to 14:161/183 of 7qv7B
- binding iron/sulfur cluster: C14 (= C15), G16 (= G17), C17 (= C18), K18 (≠ G19), A19 (≠ D20), C20 (= C21), C24 (= C25), H28 (vs. gap), R48 (≠ G40), C63 (= C51), R64 (= R52), H65 (≠ Q53), C66 (= C54), A69 (≠ P57), C71 (= C59), C75 (= C63), A79 (= A67), I80 (≠ L68), C94 (= C84), I95 (≠ V85), C97 (= C87), C100 (= C90), C104 (= C94), I109 (= I99), C139 (= C111), L141 (≠ Q113), C142 (= C114), P148 (= P118), C150 (= C120), C154 (= C124), P155 (= P125), L159 (= L129)
2vpyF Polysulfide reductase with bound quinone inhibitor, pentachlorophenol (pcp) (see paper)
30% identity, 27% coverage: 7:131/469 of query aligns to 5:142/193 of 2vpyF
- binding pentachlorophenol: I91 (≠ V85), C93 (= C87)
- binding iron/sulfur cluster: C13 (= C15), G15 (= G17), C16 (= C18), C19 (= C21), C23 (= C25), N27 (≠ S26), L36 (≠ I35), I38 (= I37), P55 (≠ T48), Q57 (≠ L50), C58 (= C51), L59 (≠ R52), C61 (= C54), P65 (≠ K58), C66 (= C59), C70 (= C63), P71 (= P64), V83 (≠ I77), C90 (= C84), I91 (≠ V85), A92 (≠ D86), C93 (= C87), G94 (≠ L88), C96 (= C90), C100 (= C94), P101 (≠ A95), Y102 (= Y96), R105 (≠ I99), V113 (= V108), C116 (= C111), F118 (≠ Q113), C119 (= C114), P129 (= P118), A130 (= A119), C131 (= C120), C135 (= C124), C139 (≠ A128), R140 (≠ L129)
Sites not aligning to the query:
Query Sequence
>WP_011384089.1 NCBI__GCF_000009985.1:WP_011384089.1
MGVAFDSISFKASLCDGCGDCMTACSQAKGGASRISIVPGAKAGSFETALCRQCGDPKCV
QVCPSGALDKDGGNGIIGWDASKCVDCLLCTAGCAYGGIAVDESVARVGKCDQCDGDPAC
VKVCPTGALEFRKAGSIFNEYGAKEDLFVPGLSGCQGCNSELIMRHAMRKIGRNSVLATP
PGCIPGMGSVGYNGKTGTKVPVFHPLLTNTASMLSGIRRYYDRIGRKDIVVMALAGDGGT
ADCGFHAVSGAAERGEKVLYVCVDNEGYMNTGMQRSGTTPYGSWTSTTPVGEHMQGKTQD
AKNLPLIMTAHKCRYVATASTGYMEDLYEKLDRAIAASFEGFSYLHIYSPCPTGWRIPSS
KVIDACRLSVDSNFNPLWEYTNTSGLRFTHSPDNAHPVSAYVKMIGKYRHLSPDQLAHIQ
AKVDEQVALLKLMAAESPPPPAAHRAPAGSSTPAGAEPSQPARREIARN
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory