Comparing WP_011384260.1 NCBI__GCF_000009985.1:WP_011384260.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 1 hits to proteins with known functional sites (download)
A0A0H2ZQB9 Ergothioneine transporter EgtUBC from Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) (see paper)
30% identity, 35% coverage: 97:186/256 of query aligns to 54:143/506 of A0A0H2ZQB9
Sites not aligning to the query:
>WP_011384260.1 NCBI__GCF_000009985.1:WP_011384260.1
MSSAAIRRAARFSSALSGLGLLVAFWALAAAGLDNPVLLPSPAEVAGVLGEVIGSGAFHR
DLGASLRRVLGGYVLASGLAVPLALVMAAWGPLRQSLLPVVSLLRPIPPIAWIPLAILWF
GLGDAPSFFITAIAAFFPIFLNAFAGGLAVGGRYLDAARCLGATRLALLLEVRLPAALPM
IATGLRIGLGQSWMAVVTAELIAAQSGLGYMIQANRLTLQTAHVLVGMVTIGTLGALMTW
AFTLAERRLLVPWQEN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory