SitesBLAST
Comparing WP_011384418.1 NCBI__GCF_000009985.1:WP_011384418.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q7WTU0 Arsenate respiratory reductase molybdopterin-containing subunit ArrA; Arsenate respiratory reductase large subunit; ARR large subunit; EC 1.20.99.1 from Shewanella sp. (strain ANA-3) (see paper)
31% identity, 27% coverage: 8:253/911 of query aligns to 57:290/854 of Q7WTU0
- C61 (= C12) binding
- C64 (= C15) binding
- C68 (= C23) binding
- C96 (= C51) binding
- R165 (≠ T122) binding
- Y166 (≠ F123) binding
- H189 (≠ F150) binding
- S190 (≠ G151) binding
- C193 (= C158) binding
- K198 (vs. gap) binding
- Y210 (≠ H170) binding
6czaA The arsenate respiratory reductase (arr) complex from shewanella sp. Ana-3 bound to phosphate (see paper)
31% identity, 27% coverage: 8:253/911 of query aligns to 17:250/814 of 6czaA
- active site: R58 (≠ K53), C153 (= C158), A154 (≠ V159)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: C24 (= C15), T25 (≠ V16), R58 (≠ K53), H149 (≠ F150), V152 (≠ K157), C153 (= C158), G185 (= G189), A190 (≠ V194), S191 (= S195), N192 (≠ G196), D215 (≠ E218), P216 (= P219), R217 (≠ H220), P233 (= P236), D236 (= D239)
- binding phosphate ion: Y126 (≠ F123), S150 (≠ G151), K158 (vs. gap)
- binding iron/sulfur cluster: C21 (= C12), G23 (≠ N14), C24 (= C15), S26 (≠ A17), W27 (≠ M22), C28 (= C23), K30 (vs. gap), C56 (= C51), R58 (≠ K53), S196 (≠ G200)
Sites not aligning to the query:
- active site: 334
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: 333, 334, 334, 335, 441, 442, 443, 444, 447, 468, 469, 472, 484, 487, 521, 681, 682, 684, 684, 686, 688, 690, 690, 691, 692, 762, 769, 787, 803, 804
6cz9A The arsenate respiratory reductase (arr) complex from shewanella sp. Ana-3 bound to arsenite (see paper)
31% identity, 27% coverage: 8:253/911 of query aligns to 17:250/814 of 6cz9A
- active site: R58 (≠ K53), C153 (= C158), A154 (≠ V159)
- binding arsenite: R125 (≠ T122), Y126 (≠ F123), H149 (≠ F150), C153 (= C158), Y170 (≠ H170)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: C24 (= C15), T25 (≠ V16), R58 (≠ K53), H149 (≠ F150), V152 (≠ K157), C153 (= C158), G185 (= G189), A190 (≠ V194), S191 (= S195), N192 (≠ G196), D215 (≠ E218), P216 (= P219), R217 (≠ H220), P233 (= P236), D236 (= D239)
- binding iron/sulfur cluster: C21 (= C12), G23 (≠ N14), C24 (= C15), S26 (≠ A17), W27 (≠ M22), C28 (= C23), K30 (vs. gap), C56 (= C51), R58 (≠ K53), S196 (≠ G200)
Sites not aligning to the query:
- active site: 334
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: 333, 334, 334, 335, 441, 442, 443, 444, 447, 468, 469, 472, 484, 487, 521, 682, 684, 684, 685, 686, 688, 690, 690, 691, 692, 762, 769, 787, 803, 804
6cz8A The arsenate respiratory reductase (arr) complex from shewanella sp. Ana-3 bound to arsenate (see paper)
31% identity, 27% coverage: 8:253/911 of query aligns to 17:250/814 of 6cz8A
- active site: R58 (≠ K53), C153 (= C158), A154 (≠ V159)
- binding arsenate: R125 (≠ T122), Y126 (≠ F123), H149 (≠ F150), C153 (= C158), Y170 (≠ H170)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: C24 (= C15), R58 (≠ K53), H149 (≠ F150), V152 (≠ K157), C153 (= C158), G185 (= G189), A190 (≠ V194), S191 (= S195), N192 (≠ G196), D215 (≠ E218), P216 (= P219), R217 (≠ H220), P233 (= P236), D236 (= D239)
- binding oxygen atom: R125 (≠ T122), H149 (≠ F150)
- binding iron/sulfur cluster: C21 (= C12), G23 (≠ N14), C24 (= C15), S26 (≠ A17), W27 (≠ M22), C28 (= C23), K30 (vs. gap), C56 (= C51), R58 (≠ K53), S196 (≠ G200)
Sites not aligning to the query:
- active site: 334
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: 333, 334, 334, 335, 441, 442, 443, 444, 447, 468, 469, 472, 484, 487, 521, 682, 684, 684, 686, 688, 690, 690, 691, 692, 762, 769, 787, 803, 804
6cz7A The arsenate respiratory reductase (arr) complex from shewanella sp. Ana-3 (see paper)
31% identity, 27% coverage: 8:253/911 of query aligns to 17:250/814 of 6cz7A
- active site: R58 (≠ K53), C153 (= C158), A154 (≠ V159)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: C24 (= C15), T25 (≠ V16), R58 (≠ K53), H149 (≠ F150), V152 (≠ K157), C153 (= C158), G185 (= G189), A190 (≠ V194), S191 (= S195), N192 (≠ G196), D215 (≠ E218), P216 (= P219), R217 (≠ H220), P233 (= P236), D236 (= D239)
- binding iron/sulfur cluster: C21 (= C12), G23 (≠ N14), C24 (= C15), S26 (≠ A17), W27 (≠ M22), C28 (= C23), K30 (vs. gap), C56 (= C51), R58 (≠ K53), V195 (≠ C199), S196 (≠ G200)
Sites not aligning to the query:
- active site: 334
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: 333, 334, 334, 335, 441, 442, 443, 444, 447, 468, 469, 472, 484, 487, 521, 681, 682, 682, 684, 684, 686, 688, 690, 690, 691, 692, 762, 769, 787, 803, 804
2vpwA Polysulfide reductase with bound menaquinone (see paper)
28% identity, 27% coverage: 4:253/911 of query aligns to 7:242/734 of 2vpwA
- active site: R52 (≠ K53), H116 (= H125), D120 (≠ P129), K138 (≠ G153), C144 (≠ V159), T145 (≠ H160)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: R52 (≠ K53), H116 (= H125), L143 (≠ C158), C144 (≠ V159), G178 (= G189), H179 (≠ T190), H180 (≠ N191), D184 (≠ S195), T185 (≠ G196), H186 (≠ G197), V206 (= V217), D207 (≠ E218), P208 (= P219), R209 (≠ H220), D228 (= D239)
- binding iron/sulfur cluster: C15 (= C12), G17 (≠ N14), C18 (= C15), W20 (≠ L21), C22 (= C23), L49 (≠ P50), C50 (= C51), R52 (≠ K53), G53 (≠ A54), N187 (≠ P198)
Sites not aligning to the query:
- active site: 303, 335, 340, 341, 351
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: 302, 303, 304, 307, 308, 410, 411, 412, 415, 416, 436, 437, 441, 453, 459, 593, 594, 596, 596, 600, 601, 602, 602, 603, 604, 668, 687, 688, 706
A0A369NIV7 Dopamine dehydroxylase; EC 1.1.-.- from Eggerthella lenta (Eubacterium lentum) (see paper)
25% identity, 30% coverage: 4:274/911 of query aligns to 45:297/1017 of A0A369NIV7
Sites not aligning to the query:
- 506 Crucial for dopamine dehydroxylation activity
2ivfA Ethylbenzene dehydrogenase from aromatoleum aromaticum (see paper)
22% identity, 62% coverage: 51:612/911 of query aligns to 63:622/912 of 2ivfA
- active site: K65 (= K53), P127 (≠ T122), D156 (≠ G151), I157 (≠ S152), M430 (≠ L427)
- binding phosphoric acid 4-(2-amino-4-oxo-3,4,5,6,-tetrahydro-pteridin-6-yl)-2-hydroxy-3,4-dimercapto-but-3-en-yl ester guanylate ester: H128 (≠ F123), H130 (= H125), A131 (≠ G126), I157 (≠ S152), D159 (≠ Q154), K386 (= K389), S543 (≠ R527), Q544 (≠ T528), N545 (= N529), R548 (≠ I532), R549 (≠ S533), R551 (≠ W535), L571 (≠ F553), E572 (≠ A554), T573 (≠ Y555), R574 (≠ T556), C588 (≠ E570), W590 (≠ T572), Y591 (≠ D573), K594 (≠ S576)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: D159 (≠ Q154), C190 (≠ G189), S191 (≠ T190), N192 (= N191), Y195 (≠ V194), T196 (≠ S195), I217 (≠ V217), P219 (= P219), D220 (≠ H220), N222 (≠ S222), G237 (≠ K237), D239 (= D239), G381 (≠ T384), F382 (≠ E385), S383 (≠ V386)
- binding iron/sulfur cluster: C63 (= C51), G66 (≠ A54)
Sites not aligning to the query:
- binding phosphoric acid 4-(2-amino-4-oxo-3,4,5,6,-tetrahydro-pteridin-6-yl)-2-hydroxy-3,4-dimercapto-but-3-en-yl ester guanylate ester: 623, 785, 791, 792, 856, 868, 869, 903
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: 21, 23, 783, 784, 785, 786, 789, 790, 791
- binding iron/sulfur cluster: 18, 22, 26, 28, 30, 62
7bkbD Formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (hexameric, composite structure) (see paper)
27% identity, 29% coverage: 6:268/911 of query aligns to 5:246/549 of 7bkbD
5chcA Crystal structure of the perchlorate reductase pcrab - substrate analog seo3 bound - from azospira suillum ps (see paper)
24% identity, 40% coverage: 12:374/911 of query aligns to 36:406/895 of 5chcA
- active site: K72 (= K53), P134 (≠ G115), P136 (= P117), W163 (= W143), Y164 (≠ G144), D166 (= D147), P168 (≠ S149)
- binding biselenite ion: F160 (≠ L140), Y164 (≠ G144), D166 (= D147)
- binding phosphoric acid 4-(2-amino-4-oxo-3,4,5,6,-tetrahydro-pteridin-6-yl)-2-hydroxy-3,4-dimercapto-but-3-en-yl ester guanylate ester: Y164 (≠ G144), D166 (= D147)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: D166 (= D147), G197 (= G189), Q202 (≠ V194), T203 (≠ S195), I224 (≠ V217), P226 (= P219), D227 (≠ H220), N229 (≠ S222), D246 (= D239)
- binding molybdenum atom: D166 (= D147)
- binding iron/sulfur cluster: C36 (= C12), G69 (≠ P50), C70 (= C51), G73 (≠ A54)
Sites not aligning to the query:
- active site: 453, 456
- binding biselenite ion: 455
- binding phosphoric acid 4-(2-amino-4-oxo-3,4,5,6,-tetrahydro-pteridin-6-yl)-2-hydroxy-3,4-dimercapto-but-3-en-yl ester guanylate ester: 422, 533, 534, 535, 539, 560, 561, 563, 565, 580, 611, 758, 760, 766, 767, 768, 831, 845, 877
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: 417, 418, 419, 423, 454, 455, 757, 759, 760, 761, 764, 765, 766, 826, 878
- binding molybdenum atom: 455
- binding iron/sulfur cluster: 28, 32, 34
5ch7A Crystal structure of the perchlorate reductase pcrab - phe164 gate switch intermediate - from azospira suillum ps (see paper)
24% identity, 40% coverage: 12:374/911 of query aligns to 35:405/894 of 5ch7A
- active site: K71 (= K53), P133 (≠ G115), P135 (= P117), W162 (= W143), Y163 (≠ G144), D165 (= D147), P167 (≠ S149)
- binding phosphoric acid 4-(2-amino-4-oxo-3,4,5,6,-tetrahydro-pteridin-6-yl)-2-hydroxy-3,4-dimercapto-but-3-en-yl ester guanylate ester: Y163 (≠ G144), D165 (= D147)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: D165 (= D147), G196 (= G189), N198 (= N191), Q201 (≠ V194), T202 (≠ S195), I223 (≠ V217), P225 (= P219), D226 (≠ H220), N228 (≠ S222), D245 (= D239)
- binding molybdenum atom: D165 (= D147)
- binding iron/sulfur cluster: C35 (= C12), G68 (≠ P50), C69 (= C51), G72 (≠ A54)
- binding zinc ion: H76 (≠ V58), D77 (≠ Q59)
Sites not aligning to the query:
- active site: 452, 455
- binding phosphoric acid 4-(2-amino-4-oxo-3,4,5,6,-tetrahydro-pteridin-6-yl)-2-hydroxy-3,4-dimercapto-but-3-en-yl ester guanylate ester: 421, 532, 533, 534, 538, 559, 560, 561, 562, 564, 576, 579, 582, 610, 757, 759, 765, 766, 767, 830, 844, 876
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: 416, 417, 418, 422, 453, 454, 756, 758, 759, 760, 763, 764, 765, 825, 877
- binding molybdenum atom: 454
- binding iron/sulfur cluster: 27, 31, 33
- binding sulfite ion: 799, 891, 893
P18775 Dimethyl sulfoxide reductase DmsA; DMSO reductase; DMSOR; Me2SO reductase; EC 1.8.5.3 from Escherichia coli (strain K12) (see 4 papers)
25% identity, 24% coverage: 42:264/911 of query aligns to 97:315/814 of P18775
- C104 (= C51) mutation to S: No alteration of the growth, expression, or catalytic activities.
- R106 (≠ K53) mutation to S: Electron transfer from the 4Fe-4S clusters of DmsB to the Mo-bisMGD of DmsA is blocked. Little effect on the coordination sphere of the molybdenum and only minor effects on its redox chemistry.
Sites not aligning to the query:
- 1:45 signal peptide, Tat-type signal
- 17 R→S: Not targeted to the membrane, does not support anaerobic growth.
- 57 K→D: No alteration of the growth, expression, or catalytic activities.
- 67 C→S: Electron transfer from the 4Fe-4S clusters of DmsB to the Mo-bisMGD of DmsA is blocked. Little effect on the coordination sphere of the molybdenum and only minor effects on its redox chemistry.
- 71 C→S: Cannot support growth.
O30078 Tetrathionate reductase subunit A; Tetrathionate reductase molybdenum subunit; EC 1.8.-.- from Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16) (see paper)
21% identity, 82% coverage: 148:897/911 of query aligns to 283:1048/1134 of O30078
Sites not aligning to the query:
- 6 R→Q: Does not affect TtrD binding.
- 15 V→Q: Strong decrease in TtrD binding.
- 17 S→Q: Does not affect TtrD binding.
- 20 V→Q: Does not affect TtrD binding.
- 22 L→Q: Does not affect TtrD binding.
- 24 G→Q: Does not affect TtrD binding.
7l5sA Crystal structure of haemophilus influenzae mtsz at ph 5.5 (see paper)
28% identity, 29% coverage: 24:289/911 of query aligns to 16:284/771 of 7l5sA
- active site: L38 (≠ K53), W113 (vs. gap), D142 (= D147), V150 (= V159), I151 (≠ H160)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: Y111 (vs. gap), G112 (vs. gap), W113 (vs. gap), W113 (vs. gap), F114 (= F123), S115 (≠ G124), S122 (≠ N131), Y143 (≠ F148), S144 (= S149), S144 (= S149), S182 (≠ G189), T187 (vs. gap), T188 (vs. gap), I191 (vs. gap), I217 (≠ V217), D218 (≠ E218), P219 (= P219), Q220 (≠ H220), D240 (= D239)
Sites not aligning to the query:
- active site: 319, 355, 356, 357
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: 319, 320, 321, 323, 323, 324, 356, 422, 423, 424, 428, 430, 448, 449, 450, 465, 471, 501, 633, 634, 635, 635, 636, 639, 640, 641, 641, 642, 643, 707, 728, 745
2v45A A new catalytic mechanism of periplasmic nitrate reductase from desulfovibrio desulfuricans atcc 27774 from crystallographic and epr data and based on detailed analysis of the sixth ligand (see paper)
29% identity, 27% coverage: 6:253/911 of query aligns to 7:239/723 of 2v45A
- active site: K49 (= K53), S109 (vs. gap), C140 (≠ L140), M141 (vs. gap), A180 (≠ G196)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: R14 (≠ Y13), K49 (= K53), Q111 (≠ G109), C140 (≠ L140), G174 (= G189), N176 (= N191), E179 (≠ S195), A180 (≠ G196), D204 (≠ E218), P205 (= P219), R206 (≠ H220), P222 (= P236), D225 (= D239)
- binding iron/sulfur cluster: C13 (= C12), C16 (= C15), T18 (≠ A17), C20 (≠ P19), L46 (≠ H44), C47 (= C51), V183 (≠ C199)
Sites not aligning to the query:
- active site: 308, 344, 345, 346
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: 307, 308, 309, 312, 313, 345, 346, 346, 416, 417, 418, 422, 443, 444, 445, 446, 461, 463, 615, 616, 617, 617, 618, 619, 621, 622, 623, 623, 624, 626, 689, 697, 713, 714
P81186 Periplasmic nitrate reductase; EC 1.9.6.1 from Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB) (see 3 papers)
29% identity, 27% coverage: 6:253/911 of query aligns to 39:271/755 of P81186
Sites not aligning to the query:
- 1:32 signal peptide, Tat-type signal
- 340 binding
- 344 binding
- 450 binding
- 475:477 binding
- 647:656 binding
- 729 binding
- 746 binding
2jirA A new catalytic mechanism of periplasmic nitrate reductase from desulfovibrio desulfuricans atcc 27774 from crystallographic and epr data and based on detailed analysis of the sixth ligand (see paper)
29% identity, 27% coverage: 6:253/911 of query aligns to 4:236/720 of 2jirA
- active site: K46 (= K53), S106 (vs. gap), C137 (≠ L140), M138 (vs. gap), A177 (≠ G196)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: R11 (≠ Y13), K46 (= K53), Q108 (≠ G109), C137 (≠ L140), G171 (= G189), S172 (≠ T190), N173 (= N191), E176 (≠ S195), A177 (≠ G196), D201 (≠ E218), P202 (= P219), R203 (≠ H220), F217 (≠ I234), D222 (= D239)
- binding iron/sulfur cluster: C10 (= C12), C13 (= C15), T15 (≠ A17), C17 (≠ P19), L43 (≠ H44), C44 (= C51), P179 (= P198), V180 (≠ C199)
Sites not aligning to the query:
- active site: 305, 341, 342, 343
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: 304, 305, 306, 309, 310, 342, 343, 343, 413, 414, 415, 419, 440, 441, 442, 458, 460, 612, 613, 614, 614, 616, 618, 619, 620, 620, 621, 623, 686, 694, 710, 711
- binding nitrite ion: 615, 686
2jiqA A new catalytic mechanism of periplasmic nitrate reductase from desulfovibrio desulfuricans atcc 27774 from crystallographic and epr data and based on detailed analysis of the sixth ligand (see paper)
29% identity, 27% coverage: 6:253/911 of query aligns to 4:236/720 of 2jiqA
- active site: K46 (= K53), S106 (vs. gap), C137 (≠ L140), M138 (vs. gap), A177 (≠ G196)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: R11 (≠ Y13), Q108 (≠ G109), C137 (≠ L140), G171 (= G189), S172 (≠ T190), E176 (≠ S195), A177 (≠ G196), D201 (≠ E218), P202 (= P219), R203 (≠ H220), P219 (= P236), D222 (= D239)
- binding iron/sulfur cluster: C10 (= C12), C13 (= C15), T15 (≠ A17), C17 (≠ P19), L43 (≠ H44), C44 (= C51), V180 (≠ C199)
Sites not aligning to the query:
- active site: 305, 341, 342, 343
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: 304, 305, 306, 309, 310, 342, 343, 343, 413, 414, 415, 419, 440, 441, 443, 458, 460, 612, 613, 614, 614, 616, 618, 619, 620, 620, 621, 623, 686, 694, 710, 711
- binding nitrate ion: 251, 583, 589, 591, 593, 704
2e7zA Acetylene hydratase from pelobacter acetylenicus (see paper)
23% identity, 27% coverage: 12:253/911 of query aligns to 6:232/727 of 2e7zA
- active site: K45 (= K53), T108 (≠ G124), I110 (≠ G126), W131 (≠ F148), C138 (vs. gap), I139 (≠ F150)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: D10 (= D20), K45 (= K53), T108 (≠ G124), N111 (≠ G127), A134 (vs. gap), M137 (vs. gap), C138 (vs. gap), G168 (= G189), K169 (≠ T190), N170 (= N191), N175 (≠ G196), W176 (≠ G197), L196 (≠ V217), D197 (≠ E218), P198 (= P219), R199 (≠ H220), Y215 (≠ P236), G216 (≠ K237), D218 (= D239)
- binding iron/sulfur cluster: C6 (= C12), S8 (≠ N14), C9 (= C15), I11 (≠ L21), N12 (≠ M22), C13 (= C23), C43 (= C51), K45 (= K53), S46 (≠ A54), W176 (≠ G197), V177 (≠ P198)
Sites not aligning to the query:
- active site: 292, 335, 336, 337
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: 292, 293, 296, 297, 413, 415, 419, 420, 439, 440, 441, 457, 462, 599, 602, 603, 603, 604, 605, 607, 608, 609, 609, 610, 611, 673, 696, 716, 717
Q71EW5 Acetylene hydratase; Ahy; EC 4.2.1.112 from Syntrophotalea acetylenica (Pelobacter acetylenicus) (see 3 papers)
23% identity, 27% coverage: 12:253/911 of query aligns to 9:235/730 of Q71EW5
- C9 (= C12) binding
- C12 (= C15) binding
- D13 (= D20) mutation to A: Almost abolishes catalytic activity.; mutation to E: Does not affect catalytic activity.
- C16 (= C23) binding
- C46 (= C51) binding
- K48 (= K53) binding ; mutation to A: Does not affect catalytic activity.
- TEIN 111:114 (≠ GHGG 124:127) binding
- C141 (vs. gap) binding
- I142 (≠ F150) mutation to A: Strongly impairs catalytic activity.
- KN 172:173 (≠ TN 190:191) binding
- HNW 177:179 (≠ SGG 195:197) binding
- LDPR 199:202 (≠ VEPH 217:220) binding
- YGTD 218:221 (≠ PKTD 236:239) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 296 binding
- 300 binding
- 416:418 binding
- 422:423 binding
- 442:444 binding
- 460 binding
- 465 binding
- 602:613 binding
- 606 binding
- 676 binding
- 699 binding
- 720 binding
Query Sequence
>WP_011384418.1 NCBI__GCF_000009985.1:WP_011384418.1
MSVETKSVPTYCYNCVAGPDLMCVTVKDGVAVAVTPNHAGMGIHPADGRPCVKAYGLVQK
TYNPHRVLTPMKRTNPRKGRDEDPGFVPISWDEALDLVAGKLRSVREMGLLNEQGMPRLA
ATFGHGGTPANYMGTFPAFLAAWGPIDFSFGSGQGVKCVHSEHLYGEYWHRAFTVAADTP
NANFIVSFGTNVEVSGGPCGVRRHADARIRGIKRVQVEPHLSPTGACSAQWVPIRPKTDP
AFMFAMLHVMLHEAPRSALDLDFLRDRTASPYLVDDEGWYLRDEATGKPLMWDGITGQPV
PHDHPGAVPALEGSFTVPAAVAKLPDGEMVRRENATARTAFTLLVDGMRGYTPDWAETIC
DVPAKVVRQVALEYLDNACVGQTTEVDGKVLPHRPVAVTLGKTVNNGWGAYECCWARTVL
ATLVGALEVPGGTLGTTVRLNRPYENRLKSVKPGEDGFMNAQMNSTKKGGWAEKPKGRNA
HTTLIPIVGDSSWAQALGPTHLAWMFLKDSPAEWAPPEPPDVWIAYRTNPAISFWDTAQL
SGNMAKMPFVVCFAYTMDETNHMADILLPEATDLESTQLIRAGGSKFVEQHWQHQGFVLR
QPAVAPQGESRDFTWITTELSRRVGLLESYNRGLNKGFALVPLKGEGFDFTLPEDQVHDV
DTIWDAVCKAATAGATKGQEVRGLDWMKENGFFMQPFAREDWYLHATMVEQGLRYELPYQ
ERLMRVGEELRRRLHEAGIQWWDEQLEEYQGIPHWHDVPGRWVKAVERAGAKAEDFPFWG
ITTKTMPYTTGNNAGIPLMNEVAGNLRGHGSVIINASSAAKLDIKDGDWVEVSSVVGHTR
GRAALVQGCRPDTVVIPGQFQHWKTPYAKDLNFPSLNTITQMSLELTDATGSGADVVRVA
LRRVDGPGEPA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory