SitesBLAST
Comparing WP_011384488.1 NCBI__GCF_000009985.1:WP_011384488.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3e9qB Crystal structure of the short chain dehydrogenase from shigella flexneri
35% identity, 95% coverage: 5:231/239 of query aligns to 16:241/256 of 3e9qB
3f1kA Crystal structure of ycik from e. Coli, an oxidoreductase, complexed with NADP+ at 2.6a resolution
36% identity, 95% coverage: 5:231/239 of query aligns to 10:235/252 of 3f1kA
- active site: S152 (≠ A146), Y165 (= Y159), K169 (= K163)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G14), D22 (≠ R17), G23 (= G18), I24 (= I19), R44 (= R39), D70 (= D65), L71 (= L66), N99 (= N92), G101 (= G94), T150 (= T144), Y165 (= Y159), K169 (= K163), P194 (= P190), G195 (= G191), G196 (≠ V192), T197 (≠ V193), T199 (= T195), M201 (≠ L197), R202 (= R198)
3gz4A Crystal structure of putative short chain dehydrogenase from escherichia coli cft073 complexed with NADPH
36% identity, 95% coverage: 5:231/239 of query aligns to 7:232/242 of 3gz4A
- active site: S149 (≠ A146), Y162 (= Y159), K166 (= K163)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G16 (= G14), S18 (= S16), G20 (= G18), I21 (= I19), R41 (= R39), K45 (≠ A43), L66 (≠ E64), D67 (= D65), L68 (= L66), N96 (= N92), G98 (= G94), T147 (= T144), Y162 (= Y159), K166 (= K163), G192 (= G191), G193 (≠ V192), T194 (≠ V193), T196 (= T195), M198 (≠ L197), R199 (= R198)
3iahA Crystal structure of short chain dehydrogenase (ycik) from salmonella enterica subsp. Enterica serovar typhimurium str. Lt2 in complex with NADP and acetate.
36% identity, 95% coverage: 5:231/239 of query aligns to 10:236/253 of 3iahA
- active site: S152 (≠ A146), Y165 (= Y159), K169 (= K163)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G14), S21 (= S16), I24 (= I19), R44 (= R39), K48 (≠ A43), D70 (= D65), L71 (= L66), N99 (= N92), G101 (= G94), T150 (= T144), Y165 (= Y159), K169 (= K163), P195 (= P190), G196 (= G191), G197 (≠ V192), T198 (≠ V193), T200 (= T195), M202 (≠ L197), R203 (= R198)
5ojiA Crystal structure of the dehydrogenase/reductase sdr family member 4 (dhrs4) from caenorhabditis elegans (see paper)
28% identity, 97% coverage: 4:235/239 of query aligns to 7:250/260 of 5ojiA
- active site: G21 (= G18), S148 (≠ A146), Y161 (= Y159), K165 (= K163)
- binding isatin: S148 (≠ A146), S150 (≠ A148), Y161 (= Y159), V193 (= V192), S199 (≠ R198), L202 (≠ A201)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A17 (≠ G14), T19 (≠ S16), I22 (= I19), S41 (≠ A38), R42 (= R39), N43 (≠ T40), N46 (≠ A43), I69 (≠ L66), N95 (= N92), H96 (≠ A93), G97 (= G94), N146 (≠ T144), S148 (≠ A146), Y161 (= Y159), K165 (= K163), G192 (= G191), I194 (≠ V193), T196 (= T195), M198 (≠ L197)
5ojgA Crystal structure of the dehydrogenase/reductase sdr family member 4 (dhrs4) from caenorhabditis elegans (see paper)
28% identity, 97% coverage: 4:235/239 of query aligns to 7:250/260 of 5ojgA
- active site: G21 (= G18), S148 (≠ A146), Y161 (= Y159), K165 (= K163)
- binding butane-2,3-dione: S148 (≠ A146), Y161 (= Y159)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A17 (≠ G14), T19 (≠ S16), G21 (= G18), I22 (= I19), S41 (≠ A38), R42 (= R39), N43 (≠ T40), N46 (≠ A43), I69 (≠ L66), N95 (= N92), H96 (≠ A93), G97 (= G94), N146 (≠ T144), S148 (≠ A146), Y161 (= Y159), K165 (= K163), P191 (= P190), I194 (≠ V193), T196 (= T195), M198 (≠ L197)
A0R518 Putative short-chain type dehydrogenase/reductase MSMEG_6031/MSMEI_5872; EC 1.1.1.- from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
31% identity, 90% coverage: 1:214/239 of query aligns to 1:221/279 of A0R518
- K65 (≠ G55) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
P50163 Tropinone reductase 2; Tropinone reductase II; TR-II; EC 1.1.1.236 from Datura stramonium (Jimsonweed) (Common thornapple) (see paper)
28% identity, 98% coverage: 1:235/239 of query aligns to 1:248/260 of P50163
- 18:41 (vs. 16:39, 42% identical) binding
- S146 (≠ A146) binding
- IATSL 192:196 (≠ VATRL 193:197) binding
4fn4A Short-chain NAD(h)-dependent dehydrogenase/reductase from sulfolobus acidocaldarius (see paper)
30% identity, 92% coverage: 5:223/239 of query aligns to 5:232/254 of 4fn4A
- active site: G18 (= G18), S144 (≠ D147), Y157 (= Y159), K161 (= K163), S202 (vs. gap)
- binding nicotinamide-adenine-dinucleotide: G14 (= G14), S17 (≠ R17), G18 (= G18), I19 (= I19), E38 (≠ A38), L39 (≠ R39), R43 (≠ A43), A63 (≠ E64), D64 (= D65), V65 (≠ L66), N91 (= N92), G93 (= G94), I94 (= I96), T142 (= T145), S144 (≠ D147), Y157 (= Y159), K161 (= K163), P187 (= P190), V190 (= V193), T192 (= T195), N193 (≠ R196), I194 (vs. gap)
3rkrA Crystal structure of a metagenomic short-chain oxidoreductase (sdr) in complex with NADP (see paper)
35% identity, 89% coverage: 5:217/239 of query aligns to 3:196/221 of 3rkrA
- active site: G16 (= G18), S142 (≠ A146), Y155 (= Y159), K159 (= K163)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G14), R15 (= R17), A36 (= A38), R37 (= R39), D38 (≠ T40), C61 (≠ P63), D62 (= D65), L63 (= L66), A90 (= A93), G91 (= G94), V92 (≠ A95), G93 (vs. gap)
6wprA Crystal structure of a putative 3-oxoacyl-acp reductase (fabg) with NADP(h) from acinetobacter baumannii (see paper)
31% identity, 90% coverage: 6:219/239 of query aligns to 4:218/244 of 6wprA
- active site: G16 (= G18), S138 (≠ A146), Y151 (= Y159)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G14), S14 (= S16), R15 (= R17), T37 (≠ R39), L58 (= L61), D59 (≠ V62), V60 (≠ P63), N86 (= N92), A87 (= A93), G88 (= G94), I89 (≠ A95), I136 (≠ T144), Y151 (= Y159), K155 (= K163), P181 (= P190)
6t62A Crystal structure of acinetobacter baumannii fabg in complex with NADPH at 1.8 a resolution (see paper)
31% identity, 90% coverage: 6:219/239 of query aligns to 4:218/244 of 6t62A
- active site: G16 (= G18), S138 (≠ A146), Y151 (= Y159)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G14), S14 (= S16), R15 (= R17), A36 (= A38), T37 (≠ R39), L58 (= L61), D59 (≠ V62), V60 (≠ P63), N86 (= N92), A87 (= A93), G88 (= G94), I89 (≠ A95), I136 (≠ T144), S137 (≠ T145), S138 (≠ A146), Y151 (= Y159), K155 (= K163), P181 (= P190), G182 (= G191), I184 (≠ V193), M188 (≠ L197)
3l77A X-ray structure alcohol dehydrogenase from archaeon thermococcus sibiricus complexed with 5-hydroxy-NADP
31% identity, 97% coverage: 6:238/239 of query aligns to 1:228/235 of 3l77A
- active site: D139 (= D147), Y151 (= Y159), K155 (= K163), P194 (vs. gap)
- binding 5-hydroxy-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE: G9 (= G14), S11 (= S16), R12 (= R17), G13 (= G18), I14 (= I19), R34 (= R39), S35 (≠ T40), L59 (≠ E64), D60 (= D65), V61 (≠ L66), N87 (= N92), A88 (= A93), G89 (= G94), T136 (= T144), T137 (= T145), S138 (≠ A146), Y151 (= Y159), K155 (= K163), P179 (= P190), G180 (= G191), A181 (≠ V192), V182 (= V193), T184 (= T195), Y185 (≠ A201), F186 (= F202)
Q73SC8 Uncharacterized NAD-dependent oxidoreductase MAP_4146; EC 1.-.-.- from Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10) (Mycobacterium paratuberculosis)
32% identity, 82% coverage: 2:197/239 of query aligns to 5:210/275 of Q73SC8
3ai2A The crystal structure of l-sorbose reductase from gluconobacter frateurii complexed with NADPH (see paper)
28% identity, 94% coverage: 1:224/239 of query aligns to 1:241/263 of 3ai2A
- active site: G18 (= G18), S144 (≠ A146), Y157 (= Y159), K161 (= K163)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G14 (= G14), S16 (= S16), S17 (≠ R17), G18 (= G18), I19 (= I19), A38 (= A38), R39 (= R39), Q40 (≠ T40), V64 (≠ E64), D65 (= D65), V66 (≠ L66), N92 (= N92), G94 (= G94), N142 (≠ T144), Y157 (= Y159), K161 (= K163), P187 (= P190), I190 (≠ V193), T192 (= T195), W195 (vs. gap)
3pgxA Crystal structure of a putative carveol dehydrogenase from mycobacterium paratuberculosis bound to nicotinamide adenine dinucleotide (see paper)
32% identity, 82% coverage: 3:197/239 of query aligns to 1:205/270 of 3pgxA
- active site: G16 (= G18), S155 (≠ A146), Y168 (= Y159), K172 (= K163)
- binding nicotinamide-adenine-dinucleotide: G12 (= G14), R15 (= R17), G16 (= G18), Q17 (≠ I19), D36 (vs. gap), I37 (vs. gap), A50 (≠ G42), D75 (= D65), V76 (≠ L66), N102 (= N92), A103 (= A93), G104 (= G94), V105 (≠ A95), V125 (= V117), V153 (≠ T144), Y168 (= Y159), K172 (= K163), P198 (= P190), V201 (= V193), T203 (= T195), M205 (≠ L197)
Sites not aligning to the query:
A0A1U8QWA2 Glycine betaine reductase ATRR; Nonribosomal peptide synthetase-like protein ATRR; EC 1.2.1.-; EC 1.1.1.- from Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans) (see paper)
32% identity, 97% coverage: 3:235/239 of query aligns to 1025:1262/1270 of A0A1U8QWA2
- 1026:1256 (vs. 4:229, 32% identical) Aldehyde reductase domain R2
- G1036 (= G14) mutation to A: Compromises binding of the cosubstrate NADPH to aldehyde reductase domain R2. Decreases the aldehyde reductase activity by 4,000-fold; when associated with F-1178.
- Y1178 (= Y159) mutation to F: Does not substantially affect carboxylic acid reductase activity but results to a 150-fold loss of aldehyde reductase activity and the accumulation of glycine betaine aldehyde intermediate. Further decreases the aldehyde reductase activity by 4,000-fold; when associated with F-1178.
Sites not aligning to the query:
- 14:418 Adenylation (A) domain
- 643:937 Carboxylic acid reductase domain R1
- 812 Y→F: Abolishes overall carboxylic acid reductase activity but does nor affect aldehyde reductase activity.
3ai3C The crystal structure of l-sorbose reductase from gluconobacter frateurii complexed with NADPH and l-sorbose (see paper)
28% identity, 94% coverage: 1:224/239 of query aligns to 1:241/263 of 3ai3C
- active site: G18 (= G18), S144 (≠ A146), Y157 (= Y159), K161 (= K163)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G14 (= G14), S16 (= S16), S17 (≠ R17), G18 (= G18), I19 (= I19), A38 (= A38), R39 (= R39), Q40 (≠ T40), R43 (≠ A43), D65 (= D65), V66 (≠ L66), N92 (= N92), G94 (= G94), N142 (≠ T144), Y157 (= Y159), K161 (= K163), P187 (= P190), G188 (= G191), I190 (≠ V193), T192 (= T195), W195 (vs. gap)
- binding L-sorbose: G96 (= G98), E154 (≠ A158), Y157 (= Y159), W195 (vs. gap)
Sites not aligning to the query:
3ai3A The crystal structure of l-sorbose reductase from gluconobacter frateurii complexed with NADPH and l-sorbose (see paper)
28% identity, 94% coverage: 1:224/239 of query aligns to 1:241/263 of 3ai3A
- active site: G18 (= G18), S144 (≠ A146), Y157 (= Y159), K161 (= K163)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G14 (= G14), S16 (= S16), S17 (≠ R17), G18 (= G18), I19 (= I19), A38 (= A38), R39 (= R39), Q40 (≠ T40), R43 (≠ A43), V64 (≠ E64), D65 (= D65), V66 (≠ L66), N92 (= N92), G94 (= G94), N142 (≠ T144), S144 (≠ A146), Y157 (= Y159), K161 (= K163), P187 (= P190), G188 (= G191), I190 (≠ V193), T192 (= T195), W195 (vs. gap)
- binding L-sorbose: G96 (= G98), S144 (≠ A146), L151 (≠ F155), E154 (≠ A158), Y157 (= Y159), G188 (= G191)
P0A2C9 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
31% identity, 81% coverage: 5:197/239 of query aligns to 3:188/244 of P0A2C9
- M125 (≠ L133) mutation to I: Loss of the temperature-sensitive phenotype; when associated with T-223.
Sites not aligning to the query:
- 223 A→T: Loss of the temperature-sensitive phenotype; when associated with I-125.
- 224 S→F: Distorts the local conformation and prevent stacking around Phe-221. The S224F mutation would additionally disrupt the hydrogen bond formed between Ser-224 and Glu-226.
Query Sequence
>WP_011384488.1 NCBI__GCF_000009985.1:WP_011384488.1
MSGRLEGRVALVTGASRGIGAAVARRLAAEGAEIVAIARTQGALEELDDQIRKAGGKPLV
LVPEDLCKPGLIEQVAAAIFQRWARLDILVGNAGAIGGGLTPVAQHAPDDWEEAFAVNVT
ANWRLIRACDPLLRMAPAGRAVFTTADAARHAEPFWGAYAASKAALETMVRTWAAEIANV
TSVKANLLDPGVVATRLRSIAFPGEDPAKLAQPDDVAGAFLDLCLPDCTRQGEIIRTSP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory