Comparing WP_011384493.1 NCBI__GCF_000009985.1:WP_011384493.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9AT00 Protein TRIGALACTOSYLDIACYLGLYCEROL 3, chloroplastic; ABC transporter I family member 13; ABC transporter ABCI.13; AtABCI13; Non-intrinsic ABC protein 11; AtNAP11 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
41% identity, 95% coverage: 7:251/257 of query aligns to 85:343/345 of Q9AT00
7chaI Cryo-em structure of p.Aeruginosa mlafebd with amppnp (see paper)
37% identity, 98% coverage: 7:257/257 of query aligns to 4:253/262 of 7chaI
7d0aB Acinetobacter mlafedb complex in adp-vanadate trapped vclose conformation (see paper)
36% identity, 97% coverage: 7:255/257 of query aligns to 5:252/263 of 7d0aB
7d08B Acinetobacter mlafedb complex in atp-bound vtrans1 conformation (see paper)
36% identity, 97% coverage: 7:255/257 of query aligns to 5:252/263 of 7d08B
6z5uK Cryo-em structure of the a. Baumannii mlabdef complex bound to appnhp (see paper)
36% identity, 97% coverage: 7:255/257 of query aligns to 3:250/253 of 6z5uK
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
37% identity, 92% coverage: 7:243/257 of query aligns to 2:236/240 of 4ymuJ
7ch8I Cryo-em structure of p.Aeruginosa mlafebd with adp-v (see paper)
37% identity, 98% coverage: 7:257/257 of query aligns to 4:250/259 of 7ch8I
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
39% identity, 88% coverage: 5:231/257 of query aligns to 1:223/241 of 4u00A
7ch6C Cryo-em structure of e.Coli mlafeb with amppnp (see paper)
35% identity, 98% coverage: 7:257/257 of query aligns to 5:254/265 of 7ch6C
6xgyA Crystal structure of e. Coli mlafb abc transport subunits in the dimeric state (see paper)
35% identity, 98% coverage: 7:257/257 of query aligns to 5:254/264 of 6xgyA
7cgnB The overall structure of the mlafedb complex in atp-bound eqtall conformation (mutation of e170q on mlaf) (see paper)
35% identity, 98% coverage: 7:257/257 of query aligns to 5:254/263 of 7cgnB
3d31A Modbc from methanosarcina acetivorans (see paper)
37% identity, 82% coverage: 22:231/257 of query aligns to 16:215/348 of 3d31A
Sites not aligning to the query:
3c4jA Abc protein artp in complex with atp-gamma-s
36% identity, 92% coverage: 7:243/257 of query aligns to 4:238/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
36% identity, 92% coverage: 7:243/257 of query aligns to 4:238/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
36% identity, 92% coverage: 7:243/257 of query aligns to 4:238/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
36% identity, 92% coverage: 7:243/257 of query aligns to 4:238/242 of 2oljA
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
33% identity, 95% coverage: 5:247/257 of query aligns to 28:267/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
33% identity, 95% coverage: 5:247/257 of query aligns to 28:267/382 of 7aheC
Sites not aligning to the query:
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
35% identity, 88% coverage: 6:231/257 of query aligns to 3:228/353 of 1oxvD
1oxvA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
35% identity, 88% coverage: 6:231/257 of query aligns to 3:228/353 of 1oxvA
>WP_011384493.1 NCBI__GCF_000009985.1:WP_011384493.1
MTSVPKIELTGVHKAFGPKVVLDGIDLSVARGESVVVIGGSGTGKSVMLKCILGLLRPES
GSIRIDGEDVVGMGPKDRDRIMKKFGMLFQGGALFDSLKVWENVAFGLIQGQKMERAKAR
DIAIEKLAQVGLAASTGELSPSELSGGMQKRVSLARAIATNPEIIFFDEPTTGLDPIMAD
VINDLIVKCCKEVGATALSITHDMASARKISDRIAMLYKGRLIWVGPAKDIDHSGNEYVD
QFIHGRAVGPITMELRA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory