Comparing WP_011384511.1 NCBI__GCF_000009985.1:WP_011384511.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
1sz2B Crystal structure of e. Coli glucokinase in complex with glucose (see paper)
47% identity, 96% coverage: 2:310/321 of query aligns to 1:307/320 of 1sz2B
8dtcA Crystal structure of glucokinase with bound glucose from acanthamoeba castellanii
23% identity, 97% coverage: 9:320/321 of query aligns to 30:359/374 of 8dtcA
6vzzA Crystal structure of glucokinase from balamuthia mandrillaris in complex with glucose (see paper)
24% identity, 93% coverage: 9:305/321 of query aligns to 30:361/374 of 6vzzA
>WP_011384511.1 NCBI__GCF_000009985.1:WP_011384511.1
MSQMVLVADIGGTHARFALMGPDGEAVNPVVLRCADYDGPAPAIKAYLAEHAGGVAPKGG
AFAVASVIDGDRIELTNSPWRFSIAETRQAVGLQRLEVVNDFTAVALSVRHLKPEHLMSV
GGGMPEAGLPIAVLGPGTGLGVSALIPSASGEWTALATEGGHVTMAAATEREARILDRLR
TQFDHVSAERVLSGQGLVNLYQAVAALSGHQAVFSTPDVITKRGLDGSCPVSREAVEVFF
AMMGTVAGNLALSLGAKGGVFIAGGILPRMAEAFRLSSFRTRFEAHGRFQPYLAAIPTWL
ITHPLPAFVGLAGLVTDPKNA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory