Comparing WP_011384538.1 NCBI__GCF_000009985.1:WP_011384538.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
1huxA Crystal structure of the acidaminococcus fermentans (r)-2- hydroxyglutaryl-coa dehydratase component a (see paper)
43% identity, 46% coverage: 224:419/430 of query aligns to 60:248/259 of 1huxA
Sites not aligning to the query:
P11568 (R)-2-hydroxyglutaryl-CoA dehydratase activating ATPase; (R)-2-hydroxyglutaryl-CoA dehydratase activase; (R)-2-hydroxyglutaryl-CoA dehydratase, component A; ATP-coupled electron transfer protein HgdC; Activator of (R)-2-hydroxyglutaryl-CoA dehydratase; EC 3.6.1.- from Acidaminococcus fermentans (strain ATCC 25085 / DSM 20731 / CCUG 9996 / CIP 106432 / VR4) (see 2 papers)
43% identity, 46% coverage: 224:419/430 of query aligns to 61:249/260 of P11568
Sites not aligning to the query:
4ehuA Activator of the 2-hydroxyisocaproyl-coa dehydratase from clostridium difficile with bound adpnp (see paper)
42% identity, 47% coverage: 225:424/430 of query aligns to 60:252/268 of 4ehuA
Sites not aligning to the query:
4ehtA Activator of the 2-hydroxyisocaproyl-coa dehydratase from clostridium difficile with bound adp (see paper)
42% identity, 47% coverage: 225:424/430 of query aligns to 60:252/268 of 4ehtA
Sites not aligning to the query:
Q5U925 2-hydroxyisocaproyl-CoA dehydratase activator; EC 3.-.-.- from Clostridioides difficile (Peptoclostridium difficile) (see paper)
42% identity, 47% coverage: 225:424/430 of query aligns to 60:252/266 of Q5U925
Sites not aligning to the query:
7yzqE Mgadp-alf4-bound dccp:dccp-r complex (see paper)
37% identity, 47% coverage: 225:424/430 of query aligns to 51:240/243 of 7yzqE
Sites not aligning to the query:
7yzmE Mgadpnp-bound dccp:dccp-r complex (see paper)
37% identity, 47% coverage: 225:424/430 of query aligns to 51:240/243 of 7yzmE
Sites not aligning to the query:
7yylE Nucleotide-free dccp:dccp-r complex (see paper)
37% identity, 47% coverage: 225:424/430 of query aligns to 51:240/243 of 7yylE
>WP_011384538.1 NCBI__GCF_000009985.1:WP_011384538.1
MRCFIGIDLGSTTTKAVVMDENLQILGRGITNSRSNYDTAAAVSKQEALIDTRLTLFRRA
LSNVPEVSGKVDDILSDLERNFRHVQFLEQLEDLQNTCIANIKGPRFAGREKVVIEALEG
TFSRLRDSSAAQYAPGVKRKSDFFRDLAGAEFMSHGEAVCKEAGLGFDLILNVYDKSIIE
VENRPPAGDMEGKFVRALEKGTMTGSSILAPVQSALAIPLEETYVVGTGYGRVRLPFPKE
HIRSEILCHGLGAHMMYPDTRTVLDIGGQDTKGIQVDPVGIVENFQMNDRCAAGCGRYLG
YIADEMNMGLHELGPLAMKSNKQVRINSTCTVFAGAELRDRLALGEKREDILAGLHRAII
LRAMSILSRAGGVKDQFTFTGGVAKNEAAVRELRKLIKENYGDVTINIDPDSIYTGALGG
ATFAVRAVVN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory