SitesBLAST
Comparing WP_011384542.1 NCBI__GCF_000009985.1:WP_011384542.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3t88A Crystal structure of escherichia coli menb in complex with substrate analogue, osb-ncoa (see paper)
34% identity, 46% coverage: 52:224/377 of query aligns to 31:202/281 of 3t88A
- active site: G82 (= G103), R87 (≠ Y108), Y93 (≠ G114), H101 (≠ Y122), L105 (≠ F126), G129 (= G151), V132 (≠ E154), G152 (= G174), S157 (= S179), D159 (≠ P181), G160 (≠ I182)
- binding o-succinylbenzoyl-N-coenzyme A: Q39 (≠ K60), V40 (≠ Q61), R41 (≠ Y62), A43 (≠ S64), S80 (≠ T101), G81 (= G102), G82 (= G103), D83 (≠ N104), Q84 (≠ T105), K85 (= K106), Y93 (≠ G114), V104 (≠ L125), L105 (≠ F126), Y125 (≠ M147), G129 (= G151), T151 (≠ A173), V155 (≠ H177), F158 (≠ A180), D159 (≠ P181)
Sites not aligning to the query:
Q5HH38 1,4-dihydroxy-2-naphthoyl-CoA synthase; DHNA-CoA synthase; EC 4.1.3.36 from Staphylococcus aureus (strain COL) (see paper)
34% identity, 48% coverage: 52:233/377 of query aligns to 24:203/273 of Q5HH38
- R34 (≠ Y62) binding in other chain
- SGGDQ 73:77 (≠ TGGNT 101:105) binding in other chain
- S149 (= S179) binding in other chain
4i42A E.Coli. 1,4-dihydroxy-2-naphthoyl coenzyme a synthase (ecmenb) in complex with 1-hydroxy-2-naphthoyl-coa (see paper)
34% identity, 46% coverage: 52:224/377 of query aligns to 35:206/285 of 4i42A
- active site: G86 (= G103), R91 (≠ Y108), Y97 (≠ G114), H105 (≠ Y122), L109 (≠ F126), G133 (= G151), V136 (≠ E154), G156 (= G174), S161 (= S179), D163 (≠ P181), G164 (≠ I182)
- binding 1-hydroxy-2-naphthoyl-CoA: V44 (≠ Q61), R45 (≠ Y62), S84 (≠ T101), G85 (= G102), G86 (= G103), D87 (≠ N104), Q88 (≠ T105), K89 (= K106), Y97 (≠ G114), V108 (≠ L125), Y129 (≠ M147), G133 (= G151), T155 (≠ A173), S161 (= S179)
Sites not aligning to the query:
P0ABU0 1,4-dihydroxy-2-naphthoyl-CoA synthase; DHNA-CoA synthase; EC 4.1.3.36 from Escherichia coli (strain K12) (see 4 papers)
34% identity, 46% coverage: 52:224/377 of query aligns to 35:206/285 of P0ABU0
- R45 (≠ Y62) binding in other chain
- SGGDQK 84:89 (≠ TGGNTK 101:106) binding in other chain
- K89 (= K106) mutation to A: Strongly decreases affinity for substrate and DHNA-CoA synthase activity.
- R91 (≠ Y108) mutation to A: Loss of DHNA-CoA synthase activity.
- Y97 (≠ G114) binding in other chain; mutation to F: Loss of DHNA-CoA synthase activity.
- YSIGG 129:133 (≠ MRIGG 147:151) binding in other chain
- Q154 (= Q172) mutation to A: Reduces the specific DHNA-CoA synthase activity by 15-fold, whereas its affinity for hydrogencarbonate is reduced by 36-fold.
- QTG 154:156 (≠ QAG 172:174) binding
- T155 (≠ A173) binding in other chain
- G156 (= G174) mutation to D: Loss of DHNA-CoA synthase activity.
- S161 (= S179) binding in other chain
- W184 (≠ G202) mutation to F: Reduces the specific DHNA-CoA synthase activity by 530-fold, whereas its affinity for hydrogencarbonate is reduced by 20-fold.
Sites not aligning to the query:
- 258 binding
- 267 R→A: Strongly decreases affinity for substrate and DHNA-CoA synthase activity.
- 270 F→A: Strongly decreases affinity for substrate and DHNA-CoA synthase activity.
- 273 binding ; K→A: Impairs protein folding.
2uzfA Crystal structure of staphylococcus aureus 1,4-dihydroxy-2-naphthoyl coa synthase (menb) in complex with acetoacetyl coa (see paper)
32% identity, 48% coverage: 52:233/377 of query aligns to 19:190/260 of 2uzfA
- active site: G70 (= G103), R80 (≠ A113), L84 (≠ Q117), G108 (= G151), V111 (≠ E154), T130 (≠ A173), G131 (= G174), S136 (= S179), D138 (≠ P181), A139 (≠ I182)
- binding acetoacetyl-coenzyme a: V28 (≠ Q61), R29 (≠ Y62), S68 (≠ T101), G69 (= G102), G70 (= G103), D71 (≠ N104), Y104 (≠ M147), G108 (= G151)
Sites not aligning to the query:
Q7CQ56 1,4-dihydroxy-2-naphthoyl-CoA synthase; DHNA-CoA synthase; EC 4.1.3.36 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
33% identity, 46% coverage: 52:224/377 of query aligns to 35:206/285 of Q7CQ56
4elxA Structure of apo e.Coli. 1,4-dihydroxy-2- naphthoyl coa synthases with cl (see paper)
33% identity, 46% coverage: 52:224/377 of query aligns to 32:189/268 of 4elxA
- active site: G83 (= G103), H88 (≠ Y108), L92 (≠ Q117), G116 (= G151), V119 (≠ E154), G139 (= G174), S144 (= S179), D146 (≠ P181), G147 (≠ I182)
- binding chloride ion: G115 (= G150), G139 (= G174), W167 (≠ G202)
Sites not aligning to the query:
4elwA Structure of e. Coli. 1,4-dihydroxy-2- naphthoyl coenzyme a synthases (menb) in complex with nitrate (see paper)
33% identity, 46% coverage: 52:224/377 of query aligns to 32:188/267 of 4elwA
- active site: G83 (= G103), L91 (≠ Q117), G115 (= G151), V118 (≠ E154), G138 (= G174), S143 (= S179), D145 (≠ P181), G146 (≠ I182)
- binding nitrate ion: G114 (= G150), T137 (≠ A173), G138 (= G174), F144 (≠ A180), W166 (≠ G202)
Sites not aligning to the query:
Q8GYN9 1,4-dihydroxy-2-naphthoyl-CoA synthase, peroxisomal; DHNS; Enoyl-CoA hydratase/isomerase D; ECHID; Naphthoate synthase; EC 4.1.3.36 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
31% identity, 51% coverage: 31:224/377 of query aligns to 77:258/337 of Q8GYN9
Sites not aligning to the query:
- 20 H→V: Loss of peroxisomal targeting.
3h02A 2.15 angstrom resolution crystal structure of naphthoate synthase from salmonella typhimurium.
32% identity, 46% coverage: 52:224/377 of query aligns to 31:187/266 of 3h02A
- active site: G82 (= G103), H86 (≠ M123), L90 (≠ N127), G114 (= G151), V117 (≠ E154), G137 (= G174), S142 (= S179), D144 (≠ P181), G145 (≠ I182)
- binding bicarbonate ion: G113 (= G150), Q135 (= Q172), G137 (= G174), W165 (≠ G202)
Sites not aligning to the query:
5jbxB Crystal structure of liuc in complex with coenzyme a and malonic acid (see paper)
33% identity, 47% coverage: 46:224/377 of query aligns to 11:185/261 of 5jbxB
- active site: A67 (≠ G103), R72 (≠ Y108), L84 (≠ M123), R88 (≠ N127), G112 (= G151), E115 (= E154), T134 (≠ A173), E135 (≠ G174), I140 (≠ S179), P142 (= P181), G143 (≠ I182)
- binding coenzyme a: S24 (≠ K60), R25 (≠ Q61), R26 (≠ Y62), A28 (≠ S64), A65 (≠ T101), D68 (≠ N104), L69 (≠ T105), K70 (= K106), L110 (≠ I149), G111 (= G150), T134 (≠ A173), E135 (≠ G174), L138 (≠ H177), R168 (≠ P207)
Sites not aligning to the query:
6slbAAA Enoyl-CoA hydratase/carnithine racemase (see paper)
27% identity, 50% coverage: 39:228/377 of query aligns to 8:185/257 of 6slbAAA
- active site: Q64 (≠ G103), F69 (≠ Y108), L80 (≠ M123), N84 (= N127), A108 (≠ G151), S111 (≠ E154), A130 (= A173), F131 (≠ G174), L136 (≠ S179), P138 (= P181), D139 (≠ I182)
- binding (~{E})-6-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethylsulfanyl]-6-oxidanylidene-hex-3-enoic acid: R58 (≠ K97), A62 (≠ T101), Q64 (≠ G103), D65 (≠ N104), L66 (≠ T105), Y76 (= Y119), A108 (≠ G151), F131 (≠ G174), D139 (≠ I182)
Sites not aligning to the query:
6slaAAA Enoyl-CoA hydratase/carnithine racemase (see paper)
27% identity, 50% coverage: 39:228/377 of query aligns to 5:173/245 of 6slaAAA
- active site: Q61 (≠ G103), L68 (≠ M123), N72 (= N127), A96 (≠ G151), S99 (≠ E154), A118 (= A173), F119 (≠ G174), L124 (≠ S179), P126 (= P181), N127 (≠ I182)
- binding ~{S}-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethyl] 2-(2,5-dihydrooxepin-7-yl)ethanethioate: L21 (≠ Y62), A59 (≠ T101), Q61 (≠ G103), D62 (≠ N104), L63 (≠ T105), L68 (≠ M123), Y71 (≠ F126), A94 (≠ I149), G95 (= G150), A96 (≠ G151), F119 (≠ G174), I122 (≠ H177), L124 (≠ S179), N127 (≠ I182)
Sites not aligning to the query:
4i52A Scmenb im complex with 1-hydroxy-2-naphthoyl-coa (see paper)
31% identity, 47% coverage: 52:229/377 of query aligns to 21:201/275 of 4i52A
- active site: G77 (= G103), R82 (≠ Y108), Y87 (≠ P116), R95 (= R124), L99 (≠ N127), G123 (= G151), V126 (≠ E154), G146 (= G174), S151 (= S179), D153 (≠ P181), G154 (≠ I182)
- binding 1-hydroxy-2-naphthoyl-CoA: H29 (≠ K60), K30 (≠ Q61), R31 (≠ Y62), A33 (≠ S64), S75 (≠ T101), G76 (= G102), G77 (= G103), D78 (≠ N104), Q79 (≠ T105), L96 (= L125), V98 (≠ F126), Y119 (≠ M147), I121 (= I149), G123 (= G151), T145 (≠ A173), V149 (≠ H177), S151 (= S179), F152 (≠ A180)
Sites not aligning to the query:
4i4zA Synechocystis sp. Pcc 6803 1,4-dihydroxy-2-naphthoyl-coenzyme a synthase (menb) in complex with salicylyl-coa (see paper)
31% identity, 47% coverage: 52:229/377 of query aligns to 21:201/275 of 4i4zA
- active site: G77 (= G103), R82 (≠ Y108), Y87 (≠ P116), R95 (= R124), L99 (≠ N127), G123 (= G151), V126 (≠ E154), G146 (= G174), S151 (= S179), D153 (≠ P181), G154 (≠ I182)
- binding Salicylyl CoA: H29 (≠ K60), K30 (≠ Q61), R31 (≠ Y62), S75 (≠ T101), G76 (= G102), G77 (= G103), D78 (≠ N104), Q79 (≠ T105), Y87 (≠ P116), V98 (≠ F126), G123 (= G151), T145 (≠ A173), V149 (≠ H177), S151 (= S179)
- binding bicarbonate ion: G122 (= G150), Q144 (= Q172), T145 (≠ A173), G146 (= G174), W174 (≠ G202)
Sites not aligning to the query:
4emlA Synechocystis sp. Pcc 6803 1,4-dihydroxy-2-naphthoyl-coenzyme a synthase (menb) in complex with bicarbonate (see paper)
29% identity, 47% coverage: 52:229/377 of query aligns to 21:187/261 of 4emlA
- active site: G77 (= G103), R81 (≠ E107), L85 (≠ Y111), G109 (= G151), V112 (≠ E154), G132 (= G174), S137 (= S179), D139 (≠ P181), G140 (≠ I182)
- binding bicarbonate ion: G108 (= G150), Q130 (= Q172), G132 (= G174), W160 (≠ G202)
- binding chloride ion: D184 (≠ L226), R185 (≠ K227), E187 (≠ D229)
Sites not aligning to the query:
5zaiC Crystal structure of 3-hydroxypropionyl-coa dehydratase from metallosphaera sedula (see paper)
26% identity, 46% coverage: 53:224/377 of query aligns to 16:183/259 of 5zaiC
- active site: A65 (≠ G103), F70 (≠ Y108), S82 (≠ M123), R86 (≠ N127), G110 (= G151), E113 (= E154), P132 (≠ A173), E133 (≠ G174), I138 (≠ S179), P140 (= P181), G141 (≠ I182)
- binding coenzyme a: K24 (≠ Q61), L25 (≠ Y62), A63 (≠ T101), G64 (= G102), A65 (≠ G103), D66 (≠ N104), I67 (≠ T105), P132 (≠ A173), R166 (≠ P207)
Sites not aligning to the query:
6iunB Crystal structure of enoyl-coa hydratase (ech) from ralstonia eutropha h16 in complex with NAD
31% identity, 46% coverage: 52:225/377 of query aligns to 11:180/692 of 6iunB
Sites not aligning to the query:
- active site: 248, 407, 428, 440, 478
- binding nicotinamide-adenine-dinucleotide: 300, 301, 302, 321, 322, 365, 377, 378, 380, 384, 388, 405, 407
3h81A Crystal structure of enoyl-coa hydratase from mycobacterium tuberculosis (see paper)
29% identity, 46% coverage: 54:225/377 of query aligns to 16:181/256 of 3h81A
- active site: A64 (≠ G103), M69 (≠ Y108), T79 (≠ M123), F83 (≠ N127), G107 (= G151), E110 (= E154), P129 (≠ A173), E130 (≠ G174), V135 (≠ S179), P137 (= P181), G138 (≠ I182)
Sites not aligning to the query:
3q0jC Crystal structure of the mycobacterium tuberculosis crotonase in complex with the inhibitor acetoacetylcoa
29% identity, 46% coverage: 54:225/377 of query aligns to 17:182/255 of 3q0jC
- active site: A65 (≠ G103), M70 (≠ Y108), T80 (≠ M123), F84 (≠ N127), G108 (= G151), E111 (= E154), P130 (≠ A173), E131 (≠ G174), V136 (≠ S179), P138 (= P181), G139 (≠ I182)
- binding acetoacetyl-coenzyme a: Q23 (≠ K60), A24 (≠ Q61), L25 (≠ Y62), A27 (≠ S64), A63 (≠ T101), G64 (= G102), A65 (≠ G103), D66 (≠ N104), I67 (≠ T105), K68 (= K106), M70 (≠ Y108), F84 (≠ N127), G107 (= G150), G108 (= G151), E111 (= E154), P130 (≠ A173), E131 (≠ G174), P138 (= P181), G139 (≠ I182), M140 (≠ G183)
Sites not aligning to the query:
Query Sequence
>WP_011384542.1 NCBI__GCF_000009985.1:WP_011384542.1
MKKETAAIVDSTAPAHLNDHNLVPTTVVPGVLYEKRPAKRADGTVAEGLYNAWITLDNQK
QYNSYTTDMVKGVIMAFRDASNARDVSSVVFTGAGDKAFCTGGNTKEYAEYYAGNPQEYR
QYMRLFNDMVSAILGCDKPVICRVNGMRIGGGQEIGMAADFSVAQDLAKFGQAGPKHGSA
PIGGATDFLPVMIGCEQAMVSGSLCEPWSAHKAYRTGIIMDLVPALKVDGKFVANPLVIT
DRYLDEFGKIVHGESKTGAELAAGKELLKKGTIDLSLLDAKVEEICAKILHTFPDCFTKT
IQELRKPKLNAWNANKENSRDWLGLNMMTEARTGFRAFNEGPKEDREIDFVALRQALAKG
APWTPELIESLIPKAGH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory