SitesBLAST
Comparing WP_011384549.1 NCBI__GCF_000009985.1:WP_011384549.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
46% identity, 97% coverage: 5:232/235 of query aligns to 3:244/247 of 4jroC
- active site: G16 (= G18), S142 (= S130), Q152 (= Q140), Y155 (= Y143), K159 (= K147)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G14), S14 (≠ M16), R15 (= R17), G16 (= G18), I17 (= I19), N35 (≠ D38), Y36 (≠ R39), N37 (vs. gap), G38 (vs. gap), S39 (vs. gap), N63 (vs. gap), V64 (vs. gap), N90 (= N78), A91 (= A79), I93 (= I81), I113 (≠ V101), S142 (= S130), Y155 (= Y143), K159 (= K147), P185 (= P173), I188 (≠ V176), T190 (= T178)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
42% identity, 97% coverage: 8:235/235 of query aligns to 5:246/246 of 3osuA
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
43% identity, 98% coverage: 5:235/235 of query aligns to 6:246/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G14), S17 (≠ M16), R18 (= R17), I20 (= I19), T40 (vs. gap), N62 (≠ D54), V63 (= V55), N89 (= N78), A90 (= A79), I92 (= I81), V139 (≠ M128), S141 (= S130), Y154 (= Y143), K158 (= K147), P184 (= P173), G185 (= G174), I187 (≠ V176), T189 (= T178), M191 (= M180)
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
42% identity, 97% coverage: 8:235/235 of query aligns to 2:239/239 of 3sj7A
- active site: G12 (= G18), S138 (= S130), Q148 (= Q140), Y151 (= Y143), K155 (= K147)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G14), S10 (≠ M16), R11 (= R17), I13 (= I19), N31 (≠ F37), Y32 (vs. gap), A33 (vs. gap), G34 (vs. gap), S35 (≠ D38), A58 (vs. gap), N59 (vs. gap), V60 (= V55), N86 (= N78), A87 (= A79), T109 (≠ V101), S138 (= S130), Y151 (= Y143), K155 (= K147), P181 (= P173), G182 (= G174)
P0AEK2 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Escherichia coli (strain K12) (see 2 papers)
41% identity, 98% coverage: 5:235/235 of query aligns to 3:243/244 of P0AEK2
- GASR 12:15 (≠ GGMR 14:17) binding
- T37 (vs. gap) binding
- NV 59:60 (≠ HA 51:52) binding
- N86 (= N78) binding
- Y151 (= Y143) mutation to F: Defect in the affinity for NADPH.
- YAAAK 151:155 (≠ YAASK 143:147) binding
- A154 (≠ S146) mutation to T: Decreases in the thermolability of the reductase; when associated with K-233.
- K155 (= K147) mutation to A: Defect in the affinity for NADPH.
- I184 (≠ V176) binding
- E233 (= E225) mutation to K: Decreases in the thermolability of the reductase; when associated with T-154.
1q7bA The structure of betaketoacyl-[acp] reductase from e. Coli in complex with NADP+ (see paper)
41% identity, 98% coverage: 5:235/235 of query aligns to 2:242/243 of 1q7bA
- active site: G15 (= G18), E101 (= E94), S137 (= S130), Q147 (= Q140), Y150 (= Y143), K154 (= K147)
- binding calcium ion: E232 (= E225), T233 (≠ V226)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G14), S13 (≠ M16), R14 (= R17), T36 (vs. gap), N58 (≠ H51), V59 (≠ A52), N85 (= N78), A86 (= A79), G87 (= G80), I88 (= I81), S137 (= S130), Y150 (= Y143), K154 (= K147), P180 (= P173), G181 (= G174), I183 (≠ V176)
4i08A Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with NADPH (see paper)
43% identity, 98% coverage: 5:235/235 of query aligns to 6:242/243 of 4i08A
- active site: G19 (= G18), N113 (= N102), S141 (= S130), Q151 (= Q140), Y154 (= Y143), K158 (= K147)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (= G14), S17 (≠ M16), R18 (= R17), I20 (= I19), T40 (vs. gap), N62 (≠ D54), V63 (= V55), N89 (= N78), A90 (= A79), G140 (≠ I129), S141 (= S130), Y154 (= Y143), K158 (= K147), P184 (= P173), G185 (= G174), T189 (= T178)
P0A2C9 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
40% identity, 98% coverage: 5:235/235 of query aligns to 3:243/244 of P0A2C9
- M125 (= M117) mutation to I: Loss of the temperature-sensitive phenotype; when associated with T-223.
- A223 (≠ L215) mutation to T: Loss of the temperature-sensitive phenotype; when associated with I-125.
- S224 (= S216) mutation to F: Distorts the local conformation and prevent stacking around Phe-221. The S224F mutation would additionally disrupt the hydrogen bond formed between Ser-224 and Glu-226.
1q7cA The structure of betaketoacyl-[acp] reductase y151f mutant in complex with NADPH fragment (see paper)
41% identity, 98% coverage: 5:235/235 of query aligns to 2:242/243 of 1q7cA
- active site: G15 (= G18), S137 (= S130), Q147 (= Q140), F150 (≠ Y143), K154 (= K147)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G11 (= G14), S13 (≠ M16), R14 (= R17), A35 (vs. gap), T36 (vs. gap), L57 (≠ A50), N58 (≠ H51), V59 (≠ A52), G87 (= G80), I88 (= I81)
6t77A Crystal structure of klebsiella pneumoniae fabg(NADPH-dependent) NADP- complex at 1.75 a resolution (see paper)
40% identity, 98% coverage: 5:235/235 of query aligns to 3:243/244 of 6t77A
- active site: G16 (= G18), S138 (= S130), Y151 (= Y143)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G14), S14 (≠ M16), R15 (= R17), T37 (vs. gap), L58 (≠ A50), N59 (≠ H51), V60 (≠ A52), A87 (= A79), G88 (= G80), I89 (= I81)
7emgB Carbonyl reductase variant 4 (r123c/l209p/f183y/v61k) from serratia marcescens complexed with NADP+ (see paper)
40% identity, 98% coverage: 5:235/235 of query aligns to 2:242/243 of 7emgB
6wprA Crystal structure of a putative 3-oxoacyl-acp reductase (fabg) with NADP(h) from acinetobacter baumannii (see paper)
40% identity, 97% coverage: 8:235/235 of query aligns to 6:243/244 of 6wprA
- active site: G16 (= G18), S138 (= S130), Y151 (= Y143)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G14), S14 (≠ M16), R15 (= R17), T37 (vs. gap), L58 (≠ V53), D59 (= D54), V60 (= V55), N86 (= N78), A87 (= A79), G88 (= G80), I89 (= I81), I136 (≠ M128), Y151 (= Y143), K155 (= K147), P181 (= P173)
6t62A Crystal structure of acinetobacter baumannii fabg in complex with NADPH at 1.8 a resolution (see paper)
40% identity, 97% coverage: 8:235/235 of query aligns to 6:243/244 of 6t62A
- active site: G16 (= G18), S138 (= S130), Y151 (= Y143)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G14), S14 (≠ M16), R15 (= R17), A36 (vs. gap), T37 (vs. gap), L58 (≠ V53), D59 (= D54), V60 (= V55), N86 (= N78), A87 (= A79), G88 (= G80), I89 (= I81), I136 (≠ M128), S137 (≠ I129), S138 (= S130), Y151 (= Y143), K155 (= K147), P181 (= P173), G182 (= G174), I184 (≠ V176), M188 (= M180)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
40% identity, 96% coverage: 8:232/235 of query aligns to 8:241/244 of 4nbuB
- active site: G18 (= G18), N111 (= N102), S139 (= S130), Q149 (= Q140), Y152 (= Y143), K156 (= K147)
- binding acetoacetyl-coenzyme a: D93 (= D84), K98 (= K89), S139 (= S130), N146 (≠ K137), V147 (≠ M138), Q149 (= Q140), Y152 (= Y143), F184 (≠ M175), M189 (= M180), K200 (= K191)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G14), N17 (≠ R17), G18 (= G18), I19 (= I19), D38 (= D38), F39 (vs. gap), V59 (= V53), D60 (= D54), V61 (= V55), N87 (= N78), A88 (= A79), G89 (= G80), I90 (= I81), T137 (≠ M128), S139 (= S130), Y152 (= Y143), K156 (= K147), P182 (= P173), F184 (≠ M175), T185 (≠ V176), T187 (= T178), M189 (= M180)
1uznA Maba from mycobacterium tuberculosis (see paper)
41% identity, 98% coverage: 2:232/235 of query aligns to 2:234/239 of 1uznA
- active site: G18 (= G18), S132 (= S130), Y145 (= Y143), K149 (= K147)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G14), N16 (≠ M16), R17 (= R17), I19 (= I19), R39 (= R39), D53 (= D54), V54 (= V55), A81 (= A79), G82 (= G80)
4k6fB X-ray crystal structure of a putative acetoacetyl-coa reductase from burkholderia cenocepacia bound to the co-factor NADP
41% identity, 97% coverage: 8:235/235 of query aligns to 2:244/245 of 4k6fB
- active site: G12 (= G18), N102 (≠ E94), S138 (= S130), Y151 (= Y143), K155 (= K147)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G14), Y32 (vs. gap), S33 (vs. gap), N36 (vs. gap), V58 (= V53), D59 (= D54), V60 (= V55), A87 (= A79), G88 (= G80), I89 (= I81)
4dmmB 3-oxoacyl-[acyl-carrier-protein] reductase from synechococcus elongatus pcc 7942 in complex with NADP
43% identity, 96% coverage: 8:232/235 of query aligns to 6:236/240 of 4dmmB
- active site: G16 (= G18), S142 (= S130), Q152 (= Q140), Y155 (= Y143), K159 (= K147)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G14), S14 (≠ M16), R15 (= R17), G16 (= G18), I17 (= I19), A37 (≠ D38), S38 (≠ R39), S39 (≠ E40), A62 (≠ V53), D63 (= D54), V64 (= V55), N90 (= N78), A91 (= A79), L113 (≠ V101), I140 (≠ M128), S142 (= S130), Y155 (= Y143), K159 (= K147), P185 (= P173), G186 (= G174), I188 (≠ V176), T190 (= T178), M192 (= M180)
4nbtA Crystal structure of fabg from acholeplasma laidlawii (see paper)
40% identity, 97% coverage: 4:232/235 of query aligns to 2:236/239 of 4nbtA
- active site: G16 (= G18), S132 (= S130), Y145 (= Y143), K149 (= K147)
- binding nicotinamide-adenine-dinucleotide: G12 (= G14), K15 (≠ R17), G16 (= G18), L17 (≠ I19), D36 (= D38), L37 (≠ A41), L52 (≠ A50), N53 (≠ H51), V54 (≠ A52), N80 (= N78), A81 (= A79), G82 (= G80), I130 (≠ M128), S132 (= S130), Y145 (= Y143), K149 (= K147), P177 (= P173), G178 (= G174), I180 (≠ V176), T182 (= T178)
4ag3A Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with NADPH at 1.8a resolution (see paper)
41% identity, 98% coverage: 5:235/235 of query aligns to 10:253/254 of 4ag3A
- active site: G23 (= G18), S148 (= S130), Y161 (= Y143), K165 (= K147)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G19 (= G14), S21 (≠ M16), R22 (= R17), G23 (= G18), I24 (= I19), T44 (≠ V36), L68 (vs. gap), D69 (= D54), V70 (= V55), N96 (= N78), A97 (= A79), I146 (≠ M128), S148 (= S130), Y161 (= Y143), K165 (= K147), P191 (= P173), G192 (= G174), F193 (≠ M175), I194 (≠ V176), T196 (= T178), M198 (= M180), T199 (= T181)
P9WGT3 3-oxoacyl-[acyl-carrier-protein] reductase MabA; 3-ketoacyl reductase; 3-ketoacyl-acyl carrier protein reductase; Acetoacetyl-CoA reductase; Beta-ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; Mycolic acid biosynthesis A; EC 1.1.1.100; EC 1.1.1.36 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 7 papers)
40% identity, 98% coverage: 2:232/235 of query aligns to 10:242/247 of P9WGT3
- T21 (= T13) modified: Phosphothreonine; mutation to A: Slight decrease in phosphorylation by PknB. Lack of phosphorylation by PknB; when associated with A-114 and A-191.
- RGI 25:27 (= RGI 17:19) binding
- R47 (= R39) binding
- C60 (≠ V53) mutation to V: Displays a lower activity than the wild-type and a slightly decreased affinity for the cofactor. Retains 84% of activity; when associated with L-144. Totally inactive; when associated with A-139 and L-144.
- DV 61:62 (= DV 54:55) binding
- G90 (= G80) binding
- T114 (= T104) modified: Phosphothreonine; mutation to A: Slight decrease in phosphorylation by PknB. Lack of phosphorylation by PknB; when associated with A-21 and A-191.
- G139 (≠ I129) mutation to A: Complete protein inactivation and freezes the catalytic site into its closed form. Totally inactive; when associated with V-60 and L-144.
- S140 (= S130) mutation to A: Loss of activity. Can still bind NADPH.; mutation to T: Loss of activity. Impaired NADPH binding.
- S144 (≠ L134) mutation to L: Stabilizes the catalytic loop in its open active form. Retains 84% of activity; when associated with V-60. Totally inactive; when associated with V-60 and A-139.
- Y185 (≠ M175) mutation to L: 70% decrease in activity with acetoacetyl-CoA as substrate. Does not affect NADP binding.
- T191 (= T181) modified: Phosphothreonine; mutation to A: Retains 22% of wild-type reductase activity. Strong decrease in phosphorylation by PknB. Lack of phosphorylation by PknB; when associated with A-21 and A-114.; mutation to D: Phosphomimetic mutant that retains less than 10% of wild-type reductase activity. Impaired NADPH binding. Overproduction of the mutant leads to a significant inhibition of de novo biosynthesis of mycolic acids.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
Query Sequence
>WP_011384549.1 NCBI__GCF_000009985.1:WP_011384549.1
MKWEFPGRVAVVTGGMRGIGRTIADGLLAGGAEVHVFDREAGELPQGMTAHAVDVSNSDS
VNAAFAAIGKPVHLLVNNAGITRDRTLLKMSDEEWGSVLTVNLTSAFNTIRAAGPGMVQA
GVGRIVNMISINGLRGKMGQGNYAASKAGMVGLTKTAAKELGSKGVTCNAVAPGMVLTEM
TLKLDQQFRDKALAEAALSILPDTTDIANAVLFLLSDAARCITGEVIKVDSGQYI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory