SitesBLAST
Comparing WP_011384698.1 NCBI__GCF_000009985.1:WP_011384698.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1mtoA Crystal structure of a phosphofructokinase mutant from bacillus stearothermophilus bound with fructose-6-phosphate (see paper)
41% identity, 94% coverage: 4:342/361 of query aligns to 2:307/319 of 1mtoA
- active site: G11 (= G13), R72 (≠ P86), C73 (≠ M87), D103 (= D117), G104 (= G118), G124 (≠ K139), T125 (= T140), D127 (= D142), D129 (= D144), R171 (= R186)
- binding 6-O-phosphono-beta-D-fructofuranose: D127 (= D142), R162 (= R177), M169 (= M184), R171 (= R186), E222 (= E237), R243 (= R278), H249 (= H284), R252 (= R287)
6pfkA Phosphofructokinase, inhibited t-state (see paper)
41% identity, 94% coverage: 4:342/361 of query aligns to 2:307/319 of 6pfkA
- active site: G11 (= G13), R72 (≠ P86), C73 (≠ M87), D103 (= D117), G104 (= G118), G124 (≠ K139), T125 (= T140), D127 (= D142), D129 (= D144), R171 (= R186)
- binding 2-phosphoglycolic acid: R21 (= R23), R25 (≠ H27), G58 (vs. gap), D59 (= D65), R154 (≠ A169), R211 (≠ E226), K213 (≠ R228)
P00512 ATP-dependent 6-phosphofructokinase; ATP-PFK; Phosphofructokinase; Phosphohexokinase; EC 2.7.1.11 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see 2 papers)
41% identity, 94% coverage: 4:342/361 of query aligns to 2:307/319 of P00512
- RSVVR 21:25 (≠ RAVVH 23:27) binding
- D59 (= D65) binding
- RC 72:73 (≠ PM 86:87) binding
- D103 (= D117) binding
- TID 125:127 (= TID 140:142) binding in other chain
- R154 (≠ A169) binding in other chain
- R162 (= R177) binding
- MGR 169:171 (= MGR 184:186) binding in other chain
- GAE 185:187 (≠ GAD 200:202) binding in other chain
- R211 (≠ E226) binding in other chain
- KKH 213:215 (≠ RNH 228:230) binding in other chain
- E222 (= E237) binding in other chain
- R243 (= R278) binding
- HVQR 249:252 (= HVQR 284:287) binding in other chain
4pfkA Phosphofructokinase. Structure and control (see paper)
40% identity, 94% coverage: 4:342/361 of query aligns to 2:307/319 of 4pfkA
- active site: G11 (= G13), R72 (≠ P86), C73 (≠ M87), D103 (= D117), G104 (= G118), G124 (≠ K139), T125 (= T140), D127 (= D142), D129 (= D144), R171 (= R186)
- binding adenosine-5'-diphosphate: S9 (= S11), Y41 (≠ S44), R72 (≠ P86), C73 (≠ M87), F76 (≠ G90), K77 (≠ S91), G104 (= G118), G108 (≠ I122), R154 (≠ A169), G185 (= G200), R211 (≠ E226), G212 (= G227), K213 (≠ R228), H215 (= H230)
- binding 6-O-phosphono-beta-D-fructofuranose: D127 (= D142), M169 (= M184), E222 (= E237), H249 (= H284), R252 (= R287)
- binding magnesium ion: G185 (= G200), E187 (≠ D202)
3pfkA Phosphofructokinase. Structure and control (see paper)
40% identity, 94% coverage: 4:342/361 of query aligns to 2:307/319 of 3pfkA
- active site: G11 (= G13), R72 (≠ P86), C73 (≠ M87), D103 (= D117), G104 (= G118), G124 (≠ K139), T125 (= T140), D127 (= D142), D129 (= D144), R171 (= R186)
- binding phosphate ion: R154 (≠ A169), K213 (≠ R228), H249 (= H284), R252 (= R287)
4i4iA Crystal structure of bacillus stearothermophilus phosphofructokinase mutant t156a bound to pep (see paper)
40% identity, 94% coverage: 4:342/361 of query aligns to 2:307/319 of 4i4iA
- active site: G11 (= G13), R72 (≠ P86), C73 (≠ M87), D103 (= D117), G104 (= G118), G124 (≠ K139), T125 (= T140), D127 (= D142), D129 (= D144), R171 (= R186)
- binding phosphoenolpyruvate: R21 (= R23), R25 (≠ H27), G58 (vs. gap), R154 (≠ A169), R211 (≠ E226), K213 (≠ R228), H215 (= H230)
5xz9A Crystal structure of phosphofructokinase from staphylococcus aureus in complex with adenylylimidodiphosphate, the atp analogue (see paper)
39% identity, 92% coverage: 4:334/361 of query aligns to 2:301/321 of 5xz9A
- binding adenosine-5'-triphosphate: S9 (= S11), Y41 (≠ S44), C73 (≠ M87), F76 (≠ G90), K77 (≠ S91), G102 (= G116), D103 (= D117), G104 (= G118), S105 (= S119), R107 (= R121), G108 (vs. gap)
5xzaA Crystal structure of phosphofructokinase from staphylococcus aureus in complex with adp (see paper)
39% identity, 92% coverage: 4:334/361 of query aligns to 2:301/322 of 5xzaA
5xz6A Crystal structure of phosphofructokinase from staphylococcus aureus in complex with adenylylimidodiphosphate, the atp analogue (see paper)
39% identity, 92% coverage: 4:334/361 of query aligns to 2:301/318 of 5xz6A
Q2FXM8 ATP-dependent 6-phosphofructokinase; ATP-PFK; Phosphofructokinase; Phosphohexokinase; EC 2.7.1.11 from Staphylococcus aureus (strain NCTC 8325 / PS 47) (see paper)
39% identity, 92% coverage: 4:334/361 of query aligns to 2:301/322 of Q2FXM8
- RC 72:73 (≠ PM 86:87) binding
- GDGS 102:105 (= GDGS 116:119) binding
- TID 127:129 (= TID 140:142) binding in other chain
- G150 (≠ E163) mutation to D: Exhibits higher affinity for fructose 6-phosphate and higher catalytic activity with a loss of dimer conversion; in association with A-151.
- L151 (≠ A164) mutation to A: Exhibits higher affinity for fructose 6-phosphate and higher catalytic activity with a loss of tetramer-dimer conversion; in association with D-150.
- R164 (= R177) mutation to A: Complete loss of fructose 6-phosphate binding.
- MGR 171:173 (= MGR 184:186) binding in other chain
- E224 (= E237) binding in other chain
- R245 (= R278) mutation to A: Complete loss of fructose 6-phosphate binding.
- HVQR 251:254 (= HVQR 284:287) binding in other chain
5xz7A Crystal structure of phosphofructokinase from staphylococcus aureus in complex with adenylylimidodiphosphate, the atp analogue (see paper)
39% identity, 92% coverage: 4:334/361 of query aligns to 2:301/322 of 5xz7A
1pfkA Crystal structure of the complex of phosphofructokinase from escherichia coli with its reaction products (see paper)
41% identity, 91% coverage: 4:333/361 of query aligns to 3:299/320 of 1pfkA
- active site: G12 (= G13), R73 (≠ N78), F74 (≠ M87), D104 (= D117), G105 (= G118), G125 (≠ K139), T126 (= T140), D128 (= D142), D130 (= D144), R172 (= R186)
- binding adenosine-5'-diphosphate: G11 (= G12), R22 (= R23), R26 (≠ H27), Y56 (≠ K60), S59 (≠ G63), D60 (= D64), R73 (≠ N78), F74 (≠ M87), F77 (≠ G90), R78 (≠ S91), G103 (= G116), D104 (= D117), G105 (= G118), S106 (= S119), M108 (vs. gap), G109 (vs. gap), R155 (≠ A169), G213 (= G227), K214 (≠ R228), H216 (= H230)
- binding 1,6-di-O-phosphono-beta-D-fructofuranose: G12 (= G13), R73 (≠ N78), T126 (= T140), D128 (= D142), M170 (= M184), E223 (= E237), H250 (= H284), R253 (= R287)
- binding magnesium ion: G186 (= G200), E188 (≠ D202)
P0A796 ATP-dependent 6-phosphofructokinase isozyme 1; ATP-PFK 1; Phosphofructokinase 1; 6-phosphofructokinase isozyme I; Phosphohexokinase 1; Sedoheptulose-7-phosphate kinase; EC 2.7.1.11 from Escherichia coli (strain K12) (see 2 papers)
41% identity, 91% coverage: 4:333/361 of query aligns to 3:299/320 of P0A796
- G12 (= G13) binding
- RGVVR 22:26 (≠ RAVVH 23:27) binding
- RYSVSD 55:60 (≠ LKSVGD 59:64) binding
- R--------F 73:74 (≠ NKGDPFAYPM 78:87) binding
- GDGS 103:106 (= GDGS 116:119) binding
- D104 (= D117) binding
- TID 126:128 (= TID 140:142) binding in other chain
- D128 (= D142) active site, Proton acceptor; mutation to S: 18000-fold reduction of catalytic rate.
- R155 (≠ A169) binding in other chain
- R163 (= R177) binding
- R172 (= R186) mutation to S: 3.4-fold reduction in turnover numbers.
- GCE 186:188 (≠ GAD 200:202) binding in other chain
- KKH 214:216 (≠ RNH 228:230) binding in other chain
- E223 (= E237) binding in other chain
- R244 (= R278) binding
- HIQR 250:253 (≠ HVQR 284:287) binding in other chain
P08237 ATP-dependent 6-phosphofructokinase, muscle type; ATP-PFK; PFK-M; 6-phosphofructokinase type A; Phosphofructo-1-kinase isozyme A; PFK-A; Phosphohexokinase; EC 2.7.1.11 from Homo sapiens (Human) (see 6 papers)
35% identity, 94% coverage: 4:341/361 of query aligns to 16:358/780 of P08237
- R39 (≠ H27) to P: in GSD7; Italian; dbSNP:rs121918193
- G57 (= G46) to V: in GSD7; Italian
- R100 (≠ V100) to Q: in dbSNP:rs2228500
- S180 (≠ T156) to C: in GSD7; Italian
- G209 (= G185) to D: in GSD7; loss of activity shown by complementation assays in yeast; dbSNP:rs767265360
- D309 (= D295) to G: in GSD7; Spanish; complete loss of enzyme activity; dbSNP:rs1169383137
Sites not aligning to the query:
- 543 D → A: in GSD7; Italian; dbSNP:rs121918194
- 557 modified: N6-(2-hydroxyisobutyryl)lysine
- 591 D → A: in GSD7; Italian
- 686 W → C: in GSD7; Japanese; dbSNP:rs121918196
- 696 R → H: in dbSNP:rs41291971
3o8lA Structure of phosphofructokinase from rabbit skeletal muscle (see paper)
34% identity, 94% coverage: 4:341/361 of query aligns to 8:350/748 of 3o8lA
- active site: G17 (= G13), R80 (≠ N78), D111 (= D117), S156 (≠ T140), D158 (= D142), D160 (= D144), R202 (= R186)
- binding adenosine-5'-diphosphate: D165 (= D149), M166 (≠ Y150), F300 (≠ R294)
- binding adenosine-5'-triphosphate: G16 (= G12), Y47 (≠ S44), R80 (≠ N78), C81 (≠ M87), R85 (≠ S91), G110 (= G116), G112 (= G118), S113 (= S119), T115 (≠ R121), G116 (vs. gap), W219 (≠ V203), H234 (≠ G215), R238 (≠ K219)
Sites not aligning to the query:
P00511 ATP-dependent 6-phosphofructokinase, muscle type; ATP-PFK; PFK-M; 6-phosphofructokinase type A; Phosphofructo-1-kinase isozyme A; PFK-A; Phosphohexokinase; EC 2.7.1.11 from Oryctolagus cuniculus (Rabbit) (see 2 papers)
34% identity, 94% coverage: 4:341/361 of query aligns to 16:358/780 of P00511
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylthreonine
- 775 modified: Phosphoserine; by PKA
4xyjA Crystal structure of human phosphofructokinase-1 in complex with atp and mg, northeast structural genomics consortium target hr9275 (see paper)
37% identity, 84% coverage: 4:307/361 of query aligns to 13:318/768 of 4xyjA
- active site: G22 (= G13), R85 (≠ N78), C86 (≠ K79), D116 (= D117), G160 (≠ K139), S161 (≠ T140), D163 (= D142), D165 (= D144), R207 (= R186)
- binding adenosine-5'-triphosphate: G21 (= G12), G22 (= G13), Y52 (≠ S44), C86 (≠ K79), F89 (≠ Y85), R90 (≠ P86), G115 (= G116), D116 (= D117), G117 (= G118), S118 (= S119), G121 (vs. gap), S161 (≠ T140), R207 (= R186)
- binding magnesium ion: G21 (= G12), G22 (= G13), D116 (= D117), D165 (= D144)
- binding phosphate ion: R32 (= R23), R36 (≠ H27), S72 (≠ D65), G221 (= G200), K252 (≠ R228)
Sites not aligning to the query:
4xykA Crystal structure of human phosphofructokinase-1 in complex with adp, northeast structural genomics consortium target hr9275 (see paper)
37% identity, 84% coverage: 4:307/361 of query aligns to 9:314/737 of 4xykA
- active site: G18 (= G13), R81 (≠ N78), C82 (≠ K79), D112 (= D117), G156 (≠ K139), S157 (≠ T140), D159 (= D142), D161 (= D144), R203 (= R186)
- binding adenosine-5'-diphosphate: Y48 (≠ S44), R81 (≠ N78), C82 (≠ K79), R86 (≠ P86), G111 (= G116), D112 (= D117), G113 (= G118), S114 (= S119)
- binding phosphate ion: R28 (= R23), R32 (≠ H27), S67 (≠ G63), K248 (≠ R228)
Sites not aligning to the query:
4xyjF Crystal structure of human phosphofructokinase-1 in complex with atp and mg, northeast structural genomics consortium target hr9275 (see paper)
37% identity, 84% coverage: 4:307/361 of query aligns to 11:316/761 of 4xyjF
- active site: G20 (= G13), R83 (≠ N78), C84 (≠ K79), D114 (= D117), G158 (≠ K139), S159 (≠ T140), D161 (= D142), D163 (= D144), R205 (= R186)
- binding adenosine-5'-triphosphate: G20 (= G13), Y50 (≠ S44), R83 (≠ N78), C84 (≠ K79), F87 (≠ Y85), R88 (≠ P86), G113 (= G116), D114 (= D117), G115 (= G118), S116 (= S119), G119 (vs. gap), S159 (≠ T140)
- binding magnesium ion: G19 (= G12), G20 (= G13), G112 (= G115), D114 (= D117), G158 (≠ K139), D163 (= D144), R205 (= R186)
- binding phosphate ion: R30 (= R23), R34 (≠ H27), S69 (≠ G63), S70 (≠ D64), G219 (= G200), K250 (≠ R228)
Sites not aligning to the query:
Q01813 ATP-dependent 6-phosphofructokinase, platelet type; ATP-PFK; PFK-P; 6-phosphofructokinase type C; Phosphofructo-1-kinase isozyme C; PFK-C; Phosphohexokinase; EC 2.7.1.11 from Homo sapiens (Human) (see paper)
37% identity, 84% coverage: 4:307/361 of query aligns to 25:330/784 of Q01813
Sites not aligning to the query:
- 386 modified: Phosphoserine; S→A: Decreased interaction with ATG4B.
Query Sequence
>WP_011384698.1 NCBI__GCF_000009985.1:WP_011384698.1
MTAKRIGILTSGGDCAGLNAALRAVVHRAIRNYGWKVFGIRDGSLGLMNRPLNYVEFDLK
SVGDDMLRLGGTILGTINKGDPFAYPMPDGSKKDRSQDFVDGYKELGIEALVVIGGDGSM
RILNELCRKGGIPMVGIPKTIDNDVAQTDYAIGFATALNVAGEAMDRLAPTAASHHRVMI
LEVMGRDVGHIALNAGIAGGADVVLIPEIPYTLEGIAKKIAEVRDEGRNHALMVVAEGCK
TETGESVTTLQSGGQARYGGIGQYLAARLAETVEAETRVTVLGHVQRGGMPAMRDRIIAS
AFGVYAVDLIAQGKLGRMVAWQHGQVVDVPITDVAGITRAIDPYGTLAQTARGLGIYIGE
M
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory