Comparing WP_011384771.1 NCBI__GCF_000009985.1:WP_011384771.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7rsfA Acetylornithine deacetylase from escherichia coli
34% identity, 94% coverage: 24:404/404 of query aligns to 2:378/380 of 7rsfA
5vo3A Crystal structure of dape in complex with the products (succinic acid and diaminopimelic acid) (see paper)
25% identity, 87% coverage: 51:403/404 of query aligns to 32:378/380 of 5vo3A
P44514 Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 3 papers)
25% identity, 87% coverage: 51:403/404 of query aligns to 28:374/377 of P44514
7uoiA Crystallographic structure of dape from enterococcus faecium
28% identity, 78% coverage: 90:404/404 of query aligns to 72:383/383 of 7uoiA
4o23A Crystal structure of mono-zinc form of succinyl diaminopimelate desuccinylase from neisseria meningitidis mc58 (see paper)
27% identity, 81% coverage: 75:401/404 of query aligns to 50:376/376 of 4o23A
4pqaA Crystal structure of succinyl-diaminopimelate desuccinylase from neisseria meningitidis mc58 in complex with the inhibitor captopril (see paper)
27% identity, 81% coverage: 75:400/404 of query aligns to 50:375/375 of 4pqaA
7t1qA Crystal structure of the succinyl-diaminopimelate desuccinylase (dape) from acinetobacter baumannii in complex with succinic acid
31% identity, 51% coverage: 75:281/404 of query aligns to 50:258/377 of 7t1qA
Sites not aligning to the query:
2f7vA Structure of acetylcitrulline deacetylase complexed with one co (see paper)
26% identity, 95% coverage: 19:400/404 of query aligns to 1:357/360 of 2f7vA
7lgpB Dape enzyme from shigella flexneri
28% identity, 61% coverage: 51:295/404 of query aligns to 30:273/377 of 7lgpB
P37111 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Sus scrofa (Pig) (see paper)
26% identity, 70% coverage: 88:371/404 of query aligns to 75:363/407 of P37111
Sites not aligning to the query:
Q8P8J5 N-acetyl-L-citrulline deacetylase; ACDase; Acetylcitrulline deacetylase; EC 3.5.1.- from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) (see paper)
27% identity, 93% coverage: 24:400/404 of query aligns to 5:362/366 of Q8P8J5
Q03154 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Homo sapiens (Human) (see 6 papers)
25% identity, 77% coverage: 88:400/404 of query aligns to 75:395/408 of Q03154
3rzaA Crystal structure of a tripeptidase (sav1512) from staphylococcus aureus subsp. Aureus mu50 at 2.10 a resolution
27% identity, 85% coverage: 28:372/404 of query aligns to 9:340/373 of 3rzaA
Sites not aligning to the query:
4h2kA Crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae (see paper)
34% identity, 31% coverage: 67:190/404 of query aligns to 44:170/258 of 4h2kA
Sites not aligning to the query:
P06621 Carboxypeptidase G2; CPDG2; Folate hydrolase G2; Glutamate carboxypeptidase; Pteroylmonoglutamic acid hydrolase G2; Glucarpidase; EC 3.4.17.11 from Pseudomonas sp. (strain RS-16) (see paper)
26% identity, 74% coverage: 1:300/404 of query aligns to 13:307/415 of P06621
Sites not aligning to the query:
1cg2A Carboxypeptidase g2 (see paper)
26% identity, 72% coverage: 10:300/404 of query aligns to 1:282/389 of 1cg2A
Sites not aligning to the query:
4op4B Crystal structure of the catalytic domain of dape protein from v.Cholerea in the zn bound form (see paper)
34% identity, 35% coverage: 50:192/404 of query aligns to 27:170/265 of 4op4B
Sites not aligning to the query:
Q96KN2 Beta-Ala-His dipeptidase; CNDP dipeptidase 1; Carnosine dipeptidase 1; Glutamate carboxypeptidase-like protein 2; Serum carnosinase; EC 3.4.13.20 from Homo sapiens (Human) (see 4 papers)
37% identity, 23% coverage: 76:169/404 of query aligns to 114:211/507 of Q96KN2
Sites not aligning to the query:
3dljA Crystal structure of human carnosine dipeptidase 1
37% identity, 23% coverage: 76:169/404 of query aligns to 83:180/471 of 3dljA
Sites not aligning to the query:
1lfwA Crystal structure of pepv (see paper)
31% identity, 37% coverage: 26:175/404 of query aligns to 15:168/468 of 1lfwA
Sites not aligning to the query:
>WP_011384771.1 NCBI__GCF_000009985.1:WP_011384771.1
MMATAHKASQSENGSLSQHTKTPLPASIETIAKLIAIDTTSYKTNLQLIDLVDKILSGLG
ASVRRTWDESKNKANIFATIGPSDVPGIVLSGHTDVVPVDGQDWSRDPFHLVQADGKLYG
RGTADMKSFIAICLAMAPQFAAAPLRMPVHFAFSYDEEVGCVGVRRLIDDLAHLPVRPAL
CIVGEPTDMKAVIGHKGKKSVRCHVEGHECHSALNHQGVNAIEIAAEMVTRLRALQRRIR
EQGPFDLGYQPPYTTVHTGTMQGGTALNIVPKSCSFEFEIRNLPDHDPETLMAEVRGWAQ
DLVPEMLAVSEASGITLDEHNSTPGLGMDEMDAAVRLVCALSGANQTSKVAFTTEAGLFQ
QAGIPAVVIGPGSITQAHRPDEFITLEQVAQCEDFLRRLLAHMC
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory