Comparing WP_011384788.1 NCBI__GCF_000009985.1:WP_011384788.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
P0AEY3 Nucleoside triphosphate pyrophosphohydrolase; NTP-PPase; EC 3.6.1.8 from Escherichia coli (strain K12) (see paper)
54% identity, 95% coverage: 7:265/273 of query aligns to 4:260/263 of P0AEY3
3crcA Crystal structure of escherichia coli mazg, the regulator of nutritional stress response (see paper)
49% identity, 93% coverage: 7:259/273 of query aligns to 3:219/225 of 3crcA
3crcB Crystal structure of escherichia coli mazg, the regulator of nutritional stress response (see paper)
47% identity, 93% coverage: 7:259/273 of query aligns to 3:213/220 of 3crcB
Q9X015 Nucleoside triphosphate pyrophosphohydrolase/pyrophosphatase MazG; NTP-PPase; EC 3.6.1.1; EC 3.6.1.9 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
39% identity, 94% coverage: 7:262/273 of query aligns to 8:250/255 of Q9X015
A0R3C4 Nucleoside triphosphate pyrophosphohydrolase; NTP-PPase; EC 3.6.1.8 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
35% identity, 58% coverage: 5:163/273 of query aligns to 82:238/324 of A0R3C4
P96379 Nucleoside triphosphate pyrophosphohydrolase; NTP-PPase; EC 3.6.1.8 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
34% identity, 56% coverage: 11:163/273 of query aligns to 91:235/325 of P96379
7yh5B Mazg(mycobacterium tuberculosis) (see paper)
38% identity, 32% coverage: 11:98/273 of query aligns to 91:177/177 of 7yh5B
2yxhA Crystal structure of mazg-related protein from thermotoga maritima
31% identity, 37% coverage: 7:106/273 of query aligns to 2:98/114 of 2yxhA
5ie9C Crystal structure of the bacillus-conserved mazg protein, a nucleotide pyrophosphohydrolase (see paper)
38% identity, 25% coverage: 165:231/273 of query aligns to 24:91/95 of 5ie9C
>WP_011384788.1 NCBI__GCF_000009985.1:WP_011384788.1
MSQDKPIDRLLAIMARLRSPQGGCPWDLEQTFATIAPYTIEEAYEVAEAIEHGDMPQLKD
ELGDLLFQVVFYAQMAKENGDFDFDAIASAISDKMIRRHPHVFVEDDGRDSAGQVEAWEE
TKARERAAKAKGANMGVLDGVARTLPPMTRALKLQNRAARVGFDWDRPETILDKLAEEAQ
EIAEEIRAEAPFDRLEDEMGDVLFVCVNLARKLNIDPERALKRANAKFERRFRHIETELN
ATGRTPQAATLDEMEALWQAAKTLEKAGGHGGG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory