SitesBLAST
Comparing WP_011384864.1 NCBI__GCF_000009985.1:WP_011384864.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0AC81 Lactoylglutathione lyase; Aldoketomutase; Glyoxalase I; Glx I; Ketone-aldehyde mutase; Methylglyoxalase; S-D-lactoylglutathione methylglyoxal lyase; EC 4.4.1.5 from Escherichia coli (strain K12) (see paper)
58% identity, 97% coverage: 5:130/130 of query aligns to 2:127/135 of P0AC81
- H5 (= H8) binding
- E56 (= E59) binding
- H74 (= H77) binding in other chain
- E122 (= E125) binding in other chain
1fa6A Crystal structure of the co(ii)-bound glyoxalase i of escherichia coli (see paper)
58% identity, 95% coverage: 5:128/130 of query aligns to 2:125/128 of 1fa6A
1fa5A Crystal structure of the zn(ii)-bound glyoxalase i of escherichia coli (see paper)
58% identity, 95% coverage: 5:128/130 of query aligns to 2:125/128 of 1fa5A
4mttA Ni- and zn-bound gloa2 at low resolution (see paper)
57% identity, 95% coverage: 5:128/130 of query aligns to 2:125/128 of 4mttA
6bnnA Crystal structure of v278e-glyoxalase i mutant from zea mays in space group p4(1)2(1)2 (see paper)
51% identity, 98% coverage: 1:128/130 of query aligns to 6:139/282 of 6bnnA
Sites not aligning to the query:
5d7zA Crystal structure of glyoxalase i from zea mays (see paper)
51% identity, 98% coverage: 2:128/130 of query aligns to 1:133/281 of 5d7zA
Sites not aligning to the query:
Q948T6 Lactoylglutathione lyase; Aldoketomutase; Allergen Glb33; Glyoxalase I; Glx I; Glyoxylase I 11; OsGLYI-11; OsGLYI11; Ketone-aldehyde mutase; Methylglyoxalase; PP33; S-D-lactoylglutathione methylglyoxal lyase; Allergen Ory s Glyoxalase I; EC 4.4.1.5 from Oryza sativa subsp. japonica (Rice) (see paper)
52% identity, 95% coverage: 5:128/130 of query aligns to 24:148/291 of Q948T6
- E78 (= E59) mutation to Q: No effect on the activity.
- E145 (= E125) mutation to Q: Loss of activity.
Sites not aligning to the query:
- 209 E→D: Loss of activity.
2c21A Specificity of the trypanothione-dependednt leishmania major glyoxalase i: structure and biochemical comparison with the human enzyme (see paper)
50% identity, 97% coverage: 5:130/130 of query aligns to 3:123/139 of 2c21A
P50107 Glyoxalase I; Glx I; Aldoketomutase; Ketone-aldehyde mutase; Methylglyoxalase; S-D-lactoylglutathione methylglyoxal lyase; actoylglutathione lyase; EC 4.4.1.5 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
41% identity, 95% coverage: 5:127/130 of query aligns to 182:320/326 of P50107
- E318 (= E125) active site, Proton donor/acceptor
Sites not aligning to the query:
- 163 active site, Proton donor/acceptor
Q04760 Lactoylglutathione lyase; Aldoketomutase; Glyoxalase I; Glx I; Ketone-aldehyde mutase; Methylglyoxalase; S-D-lactoylglutathione methylglyoxal lyase; EC 4.4.1.5 from Homo sapiens (Human) (see 12 papers)
36% identity, 97% coverage: 3:128/130 of query aligns to 29:176/184 of Q04760
- Q34 (≠ H8) binding ; mutation to E: Reduces enzyme activity by 99%.
- S45 (= S19) mutation to A: No effect on phosphorylation.
- C61 (≠ T35) modified: Disulfide link with 139, Alternate; mutation to A: No effect on NO-mediated modification.
- S69 (≠ T43) mutation to A: No effect on phosphorylation.
- S94 (≠ A53) mutation to A: No effect on phosphorylation.
- T98 (≠ V57) mutation to A: No effect on phosphorylation.
- E100 (= E59) binding ; mutation to Q: Reduces enzyme activity by over 99%.
- T102 (= T61) mutation to A: No effect on phosphorylation.
- T107 (vs. gap) modified: Phosphothreonine; mutation to A: Loss of phosphorylation.
- E111 (≠ D65) to A: in dbSNP:rs4746
- H127 (= H77) binding in other chain
- C139 (= C89) modified: S-glutathionyl cysteine; alternate; modified: Disulfide link with 61, Alternate; mutation to A: Impaired NO-mediated modification. Loss of NO-mediated modification; when associated with A-19 or A-20.
- E173 (= E125) active site, Proton donor/acceptor; binding in other chain; mutation to Q: Abolishes enzyme activity.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
- 19 modified: Disulfide link with 20; C → Y: in dbSNP:rs17855424; C→A: No effect on NO-mediated modification. Impaired NO-mediated modification; when associated with A-20. Loss of NO-mediated modification; when associated with A-139.
- 20 modified: Disulfide link with 19; C→A: No effect on NO-mediated modification. Impaired NO-mediated modification; when associated with A-19. Loss of NO-mediated modification; when associated with A-139.
3w0tA Human glyoxalase i with an n-hydroxypyridone derivative inhibitor
36% identity, 97% coverage: 3:128/130 of query aligns to 21:168/176 of 3w0tA
- active site: Q26 (≠ H8), E92 (= E59), H119 (= H77), E165 (= E125)
- binding N-[3-(1-hydroxy-6-oxo-4-phenyl-1,6-dihydropyridin-2-yl)phenyl]methanesulfonamide: Q26 (≠ H8), C53 (≠ T35), F55 (≠ Y37), F60 (= F42), L62 (= L44), F64 (= F46), E92 (= E59), T94 (= T61), H119 (= H77), M150 (= M106), E165 (= E125)
- binding zinc ion: Q26 (≠ H8), E92 (= E59), H119 (= H77), E165 (= E125)
Sites not aligning to the query:
3vw9A Human glyoxalase i with an n-hydroxypyridone inhibitor (see paper)
36% identity, 97% coverage: 3:128/130 of query aligns to 21:168/176 of 3vw9A
- active site: Q26 (≠ H8), E92 (= E59), H119 (= H77), E165 (= E125)
- binding 1-hydroxy-6-[1-(3-methoxypropyl)-1H-pyrrolo[2,3-b]pyridin-5-yl]-4-phenylpyridin-2(1H)-one: Q26 (≠ H8), C53 (≠ T35), F55 (≠ Y37), F60 (= F42), L62 (= L44), F64 (= F46), I81 (vs. gap), L85 (vs. gap), E92 (= E59), H119 (= H77), M150 (= M106), L153 (≠ I113), F155 (= F115), W163 (≠ K123), E165 (= E125)
- binding zinc ion: Q26 (≠ H8), E92 (= E59), H119 (= H77), E165 (= E125)
Sites not aligning to the query:
1qipA Human glyoxalase i complexed with s-p- nitrobenzyloxycarbonylglutathione (see paper)
36% identity, 97% coverage: 3:128/130 of query aligns to 21:168/176 of 1qipA
- active site: Q26 (≠ H8), E92 (= E59), H119 (= H77), E165 (= E125)
- binding s-p-nitrobenzyloxycarbonylglutathione: R30 (= R12), Q51 (≠ R33), C53 (≠ T35), F55 (≠ Y37), F60 (= F42), L62 (= L44), F64 (= F46), I81 (vs. gap), L85 (vs. gap), T94 (= T61), N96 (= N63), R115 (vs. gap), M150 (= M106), L153 (≠ I113), F155 (= F115), W163 (≠ K123), E165 (= E125)
- binding zinc ion: Q26 (≠ H8), E92 (= E59), H119 (= H77), E165 (= E125)
Sites not aligning to the query:
1qinA Human glyoxalase i complexed with s-(n-hydroxy-n-p- iodophenylcarbamoyl) glutathione (see paper)
36% identity, 97% coverage: 3:128/130 of query aligns to 21:168/176 of 1qinA
- active site: Q26 (≠ H8), E92 (= E59), H119 (= H77), E165 (= E125)
- binding s-(n-hydroxy-n-iodophenylcarbamoyl)glutathione: Q26 (≠ H8), R30 (= R12), F60 (= F42), L62 (= L44), F64 (= F46), L85 (vs. gap), E92 (= E59), T94 (= T61), N96 (= N63), R115 (vs. gap), H119 (= H77), K143 (≠ R101), G148 (= G104), K149 (≠ P105), M150 (= M106), L153 (≠ I113), F155 (= F115), E165 (= E125)
- binding zinc ion: Q26 (≠ H8), E92 (= E59)
Sites not aligning to the query:
1froA Human glyoxalase i with benzyl-glutathione inhibitor (see paper)
36% identity, 97% coverage: 3:128/130 of query aligns to 21:168/176 of 1froA
- active site: Q26 (≠ H8), E92 (= E59), H119 (= H77), E165 (= E125)
- binding s-benzyl-glutathione: R30 (= R12), F55 (≠ Y37), F60 (= F42), L62 (= L44), T94 (= T61), N96 (= N63), R115 (vs. gap), M150 (= M106), L153 (≠ I113), F155 (= F115), W163 (≠ K123), E165 (= E125)
- binding zinc ion: Q26 (≠ H8), E92 (= E59), H119 (= H77), E165 (= E125)
Sites not aligning to the query:
7wt0A Human glyoxalase i (with c-ter his tag) in complex with tlsc702 (see paper)
36% identity, 97% coverage: 3:128/130 of query aligns to 28:175/185 of 7wt0A
- binding (~{E})-3-(1,3-benzothiazol-2-yl)-4-(4-methoxyphenyl)but-3-enoic acid: C60 (≠ T35), F62 (≠ Y37), L69 (= L44), F71 (= F46), L92 (vs. gap), E99 (= E59), H126 (= H77), K150 (≠ R101), M157 (= M106), L160 (≠ I113), F162 (= F115), W170 (≠ K123), E172 (= E125)
- binding zinc ion: Q33 (≠ H8), E99 (= E59), H126 (= H77), E172 (= E125)
Sites not aligning to the query:
3w0uA Human glyoxalase i with an n-hydroxypyridone inhibitor
36% identity, 97% coverage: 3:128/130 of query aligns to 21:168/175 of 3w0uA
- active site: Q26 (≠ H8), E92 (= E59), H119 (= H77), E165 (= E125)
- binding N-[3-(1-Hydroxy-6-oxo-4-phenyl-1,6-dihydro-pyridin-2-yl)-5-methanesulfonylamino-phenyl]-methanesulfonamide: Q26 (≠ H8), C53 (≠ T35), F55 (≠ Y37), M58 (≠ G40), F60 (= F42), L62 (= L44), F64 (= F46), I81 (vs. gap), E92 (= E59), T94 (= T61), H119 (= H77), K143 (≠ R101), K149 (≠ P105), M150 (= M106), L153 (≠ I113), F155 (= F115), E165 (= E125)
- binding zinc ion: Q26 (≠ H8), E92 (= E59), H119 (= H77), E165 (= E125)
Sites not aligning to the query:
6l0uB Crystal structure of mouse glyoxalase i complexed with a small molecule inhibitor
36% identity, 97% coverage: 3:128/130 of query aligns to 22:169/177 of 6l0uB
- active site: Q27 (≠ H8), E93 (= E59), H120 (= H77), E166 (= E125)
- binding N-[4-(trifluoromethyloxy)phenyl]-1,3,4,9-tetrahydropyrido[3,4-b]indole-2-carbothioamide: R116 (vs. gap), V143 (≠ T100), K144 (≠ R101), D148 (vs. gap), G149 (= G104), W164 (≠ K123)
- binding zinc ion: Q27 (≠ H8), E93 (= E59), H120 (= H77), E166 (= E125)
4kykB Crystal structure of mouse glyoxalase i complexed with indomethacin (see paper)
36% identity, 97% coverage: 3:128/130 of query aligns to 22:169/177 of 4kykB
- active site: Q27 (≠ H8), E93 (= E59), H120 (= H77), E166 (= E125)
- binding indomethacin: K144 (≠ R101), G149 (= G104), K150 (≠ P105), M151 (= M106), L154 (≠ I113), F156 (= F115), E166 (= E125)
- binding zinc ion: Q27 (≠ H8), E93 (= E59), H120 (= H77), E166 (= E125)
6l0uA Crystal structure of mouse glyoxalase i complexed with a small molecule inhibitor
36% identity, 97% coverage: 3:128/130 of query aligns to 24:171/179 of 6l0uA
- active site: Q29 (≠ H8), E95 (= E59), H122 (= H77), E168 (= E125)
- binding N-[4-(trifluoromethyloxy)phenyl]-1,3,4,9-tetrahydropyrido[3,4-b]indole-2-carbothioamide: R33 (= R12), N99 (= N63)
- binding zinc ion: Q29 (≠ H8), E95 (= E59), H122 (= H77), E168 (= E125)
Query Sequence
>WP_011384864.1 NCBI__GCF_000009985.1:WP_011384864.1
MADWRFLHTMIRVGNLDRSIHFYTSLLGMKLLRRTDYPEGRFTLAFVGYGEEASNTVVEL
THNWDTESYELGGGFGHLALGVPDIYKACAELEAAGAKITRAPGPMKHGSTIIAFVEDPD
GYKIELIQAK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory