Comparing WP_011384921.1 NCBI__GCF_000009985.1:WP_011384921.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
43% identity, 96% coverage: 7:228/232 of query aligns to 1:224/232 of 1f3oA
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
42% identity, 96% coverage: 7:228/232 of query aligns to 1:224/230 of 1l2tA
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
42% identity, 96% coverage: 5:227/232 of query aligns to 3:223/233 of P75957
7mdyC Lolcde nucleotide-bound
42% identity, 96% coverage: 6:227/232 of query aligns to 1:220/226 of 7mdyC
7arlD Lolcde in complex with lipoprotein and adp (see paper)
42% identity, 96% coverage: 6:227/232 of query aligns to 1:220/222 of 7arlD
7v8iD Lolcd(e171q)e with bound amppnp in nanodiscs (see paper)
41% identity, 96% coverage: 5:227/232 of query aligns to 2:222/229 of 7v8iD
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
41% identity, 94% coverage: 7:225/232 of query aligns to 3:218/592 of 5lj7A
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
41% identity, 94% coverage: 7:225/232 of query aligns to 3:218/615 of 5lilA
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
41% identity, 97% coverage: 7:232/232 of query aligns to 3:225/226 of 5xu1B
5ws4A Crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii (see paper)
42% identity, 95% coverage: 5:225/232 of query aligns to 2:219/650 of 5ws4A
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
42% identity, 94% coverage: 7:225/232 of query aligns to 4:219/648 of P75831
2pclA Crystal structure of abc transporter with complex (aq_297) from aquifex aeolicus vf5
42% identity, 87% coverage: 25:225/232 of query aligns to 17:214/223 of 2pclA
7w78A Heme exporter hrtba in complex with mg-amppnp (see paper)
41% identity, 90% coverage: 17:225/232 of query aligns to 14:213/218 of 7w78A
7w79A Heme exporter hrtba in complex with mn-amppnp (see paper)
41% identity, 90% coverage: 17:225/232 of query aligns to 14:213/216 of 7w79A
Sites not aligning to the query:
8g4cB Bceabs atpgs high res tm (see paper)
31% identity, 96% coverage: 5:227/232 of query aligns to 1:221/248 of 8g4cB
7tchB Bceab e169q variant atp-bound conformation (see paper)
31% identity, 96% coverage: 6:227/232 of query aligns to 1:220/245 of 7tchB
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
36% identity, 93% coverage: 7:222/232 of query aligns to 1:213/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
35% identity, 93% coverage: 7:222/232 of query aligns to 2:214/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
35% identity, 93% coverage: 7:222/232 of query aligns to 2:214/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
35% identity, 93% coverage: 7:222/232 of query aligns to 2:214/344 of 6cvlD
>WP_011384921.1 NCBI__GCF_000009985.1:WP_011384921.1
MTGPQVLAELTGIAKHFGEGASRVDALRGVDLSLHPGEVVGLLGPSGSGKSTLLNIIGCV
VEPNAGRMVLDGVVVYDGAWTGGDLRRLRLDKIGFIFQFHNLLPFLNSRDNVAVVLELAG
QDPAAARRRAGELLDYLEVGARAEASPGQLSGGEAQRVAIARALANNPRLILADEPTAAL
DSQRAAIVMDLLIKVAREQNAAVLVVSHDEKIYDRFDRMVRVRDGVLESGSA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory