SitesBLAST
Comparing WP_011384931.1 NCBI__GCF_000009985.1:WP_011384931.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P09342 Acetolactate synthase 1, chloroplastic; ALS I; Acetohydroxy-acid synthase I; Acetolactate synthase I; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see 2 papers)
29% identity, 96% coverage: 1:539/561 of query aligns to 85:638/667 of P09342
- C161 (= C77) modified: Disulfide link with 307
- P194 (≠ D110) mutation to Q: In C3; highly resistant to sulfonylurea herbicides.
- C307 (≠ T219) modified: Disulfide link with 161
P09114 Acetolactate synthase 2, chloroplastic; ALS II; Acetohydroxy-acid synthase II; Acetolactate synthase II; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see paper)
29% identity, 96% coverage: 1:539/561 of query aligns to 82:635/664 of P09114
- P191 (≠ D110) mutation to A: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with L-568.
- W568 (≠ H480) mutation to L: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with A-191.
1t9dB Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, metsulfuron methyl (see paper)
27% identity, 95% coverage: 10:543/561 of query aligns to 8:544/582 of 1t9dB
- active site: Y28 (≠ V30), G30 (= G32), G31 (≠ E33), A32 (≠ S34), I33 (≠ F35), E54 (= E57), T77 (≠ G80), F116 (= F119), Q117 (= Q120), E118 (= E121), K166 (≠ E169), R213 (= R224), M249 (≠ Y260), V276 (≠ D287), V392 (≠ A392), L417 (vs. gap), G418 (= G417), M420 (= M419), D445 (= D444), N472 (= N471), E474 (≠ M473), Q475 (≠ Y474), M477 (≠ T476), V478 (≠ I477), W481 (≠ H480), L503 (= L502), G508 (≠ D507), L509 (≠ A508), K542 (≠ P541)
- binding methyl 2-[({[(4-methoxy-6-methyl-1,3,5-triazin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: G31 (≠ E33), A32 (≠ S34), V106 (= V109), P107 (≠ D110), F116 (= F119), K166 (≠ E169), M249 (≠ Y260), D274 (= D285), R275 (≠ I286), W481 (≠ H480)
- binding flavin-adenine dinucleotide: R156 (= R159), G202 (= G214), A203 (≠ G215), G204 (= G216), N207 (≠ T219), T229 (≠ C240), L230 (≠ F241), Q231 (≠ R242), L247 (= L258), M249 (≠ Y260), H250 (≠ S261), G269 (= G280), A270 (≠ T281), R271 (= R282), D273 (≠ G284), R275 (≠ I286), V276 (≠ D287), E302 (≠ F307), V303 (≠ P308), N307 (≠ E312), G320 (vs. gap), D321 (vs. gap), A322 (vs. gap), Q396 (≠ T396), M397 (≠ G397), G415 (≠ N416), G416 (vs. gap)
- binding magnesium ion: D445 (= D444), N472 (= N471), E474 (≠ M473)
- binding 2,5-dimethyl-pyrimidin-4-ylamine: E54 (= E57), P80 (= P83), G418 (= G417), M420 (= M419), M450 (= M449)
1t9bA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorsulfuron (see paper)
27% identity, 95% coverage: 10:543/561 of query aligns to 9:545/583 of 1t9bA
- active site: Y29 (≠ V30), G31 (= G32), G32 (≠ E33), A33 (≠ S34), I34 (≠ F35), E55 (= E57), T78 (≠ G80), F117 (= F119), Q118 (= Q120), E119 (= E121), K167 (≠ E169), R214 (= R224), M250 (≠ Y260), V277 (≠ D287), V393 (≠ A392), L418 (vs. gap), G419 (= G417), M421 (= M419), D446 (= D444), N473 (= N471), E475 (≠ M473), Q476 (≠ Y474), M478 (≠ T476), V479 (≠ I477), W482 (≠ H480), L504 (= L502), G509 (≠ D507), L510 (≠ A508), K543 (≠ P541)
- binding 1-(2-chlorophenylsulfonyl)-3-(4-methoxy-6-methyl-l,3,5-triazin-2-yl)urea: V107 (= V109), P108 (≠ D110), F117 (= F119), D275 (= D285), R276 (≠ I286), M478 (≠ T476), W482 (≠ H480)
- binding flavin-adenine dinucleotide: R157 (= R159), G203 (= G214), A204 (≠ G215), G205 (= G216), N208 (≠ T219), T230 (≠ C240), L231 (≠ F241), Q232 (≠ R242), M247 (≠ E257), L248 (= L258), M250 (≠ Y260), H251 (≠ S261), G270 (= G280), A271 (≠ T281), R272 (= R282), D274 (≠ G284), R276 (≠ I286), V277 (≠ D287), E303 (≠ F307), V304 (≠ P308), N308 (≠ E312), D322 (vs. gap), A323 (vs. gap), Q397 (≠ T396), M398 (≠ G397), G416 (≠ N416), G417 (vs. gap)
- binding magnesium ion: D446 (= D444), N473 (= N471), E475 (≠ M473)
1t9cA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, sulfometuron methyl (see paper)
27% identity, 95% coverage: 10:542/561 of query aligns to 9:557/596 of 1t9cA
- active site: Y29 (≠ V30), G31 (= G32), G32 (≠ E33), A33 (≠ S34), I34 (≠ F35), E55 (= E57), T78 (≠ G80), F117 (= F119), Q118 (= Q120), E119 (= E121), K167 (≠ E169), R227 (= R224), M263 (≠ Y260), V290 (≠ D287), V406 (≠ A392), L431 (vs. gap), G432 (= G417), M434 (= M419), D459 (= D444), N486 (= N471), E488 (≠ M473), Q489 (≠ Y474), M491 (≠ T476), V492 (≠ I477), W495 (≠ H480), L517 (= L502), G522 (≠ D507), L523 (≠ A508), K556 (≠ P541)
- binding methyl 2-[({[(4,6-dimethylpyrimidin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: G32 (≠ E33), V107 (= V109), P108 (≠ D110), F117 (= F119), K167 (≠ E169), D288 (= D285), R289 (≠ I286), W495 (≠ H480)
- binding flavin-adenine dinucleotide: R157 (= R159), G216 (= G214), A217 (≠ G215), G218 (= G216), N221 (≠ T219), T243 (≠ C240), L244 (≠ F241), Q245 (≠ R242), L261 (= L258), M263 (≠ Y260), H264 (≠ S261), G283 (= G280), A284 (≠ T281), R285 (= R282), D287 (≠ G284), R289 (≠ I286), V290 (≠ D287), E316 (≠ F307), V317 (≠ P308), N321 (≠ E312), G334 (vs. gap), D335 (vs. gap), A336 (vs. gap), M411 (≠ G397), G429 (≠ N416), G430 (vs. gap)
- binding magnesium ion: D459 (= D444), N486 (= N471), E488 (≠ M473)
1t9dA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, metsulfuron methyl (see paper)
27% identity, 95% coverage: 10:543/561 of query aligns to 9:558/596 of 1t9dA
- active site: Y29 (≠ V30), G31 (= G32), G32 (≠ E33), A33 (≠ S34), I34 (≠ F35), E55 (= E57), T78 (≠ G80), F117 (= F119), Q118 (= Q120), E119 (= E121), K167 (≠ E169), R227 (= R224), M263 (≠ Y260), V290 (≠ D287), V406 (≠ A392), L431 (vs. gap), G432 (= G417), M434 (= M419), D459 (= D444), N486 (= N471), E488 (≠ M473), Q489 (≠ Y474), M491 (≠ T476), V492 (≠ I477), W495 (≠ H480), L517 (= L502), G522 (≠ D507), L523 (≠ A508), K556 (≠ P541)
- binding methyl 2-[({[(4-methoxy-6-methyl-1,3,5-triazin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: G32 (≠ E33), A33 (≠ S34), V107 (= V109), P108 (≠ D110), F117 (= F119), K167 (≠ E169), M263 (≠ Y260), D288 (= D285), R289 (≠ I286), W495 (≠ H480)
- binding flavin-adenine dinucleotide: R157 (= R159), G216 (= G214), A217 (≠ G215), G218 (= G216), N221 (≠ T219), T243 (≠ C240), L244 (≠ F241), Q245 (≠ R242), M260 (≠ E257), L261 (= L258), H264 (≠ S261), G283 (= G280), A284 (≠ T281), R285 (= R282), D287 (≠ G284), R289 (≠ I286), V290 (≠ D287), E316 (≠ F307), V317 (≠ P308), N321 (≠ E312), G334 (vs. gap), D335 (vs. gap), A336 (vs. gap), Q410 (≠ T396), M411 (≠ G397), G429 (≠ N416), G430 (vs. gap)
- binding magnesium ion: D459 (= D444), N486 (= N471), E488 (≠ M473)
- binding 2,5-dimethyl-pyrimidin-4-ylamine: E55 (= E57), P81 (= P83), Q118 (= Q120), G432 (= G417), M434 (= M419), M464 (= M449)
1t9aA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, tribenuron methyl (see paper)
27% identity, 95% coverage: 10:543/561 of query aligns to 10:559/597 of 1t9aA
- active site: Y30 (≠ V30), G32 (= G32), G33 (≠ E33), A34 (≠ S34), I35 (≠ F35), E56 (= E57), T79 (≠ G80), F118 (= F119), Q119 (= Q120), E120 (= E121), K168 (≠ E169), R228 (= R224), M264 (≠ Y260), V291 (≠ D287), V407 (≠ A392), L432 (vs. gap), G433 (= G417), M435 (= M419), D460 (= D444), N487 (= N471), E489 (≠ M473), Q490 (≠ Y474), M492 (≠ T476), V493 (≠ I477), W496 (≠ H480), L518 (= L502), G523 (≠ D507), L524 (≠ A508), K557 (≠ P541)
- binding methyl 2-[4-methoxy-6-methyl-1,3,5-trazin-2-yl(methyl)carbamoylsulfamoyl]benzoate: G33 (≠ E33), V108 (= V109), P109 (≠ D110), F118 (= F119), K168 (≠ E169), M264 (≠ Y260), D289 (= D285), R290 (≠ I286), M492 (≠ T476), V493 (≠ I477), W496 (≠ H480)
- binding flavin-adenine dinucleotide: R158 (= R159), G217 (= G214), A218 (≠ G215), G219 (= G216), N222 (≠ T219), T244 (≠ C240), L245 (≠ F241), Q246 (≠ R242), L262 (= L258), M264 (≠ Y260), H265 (≠ S261), G284 (= G280), A285 (≠ T281), R286 (= R282), D288 (≠ G284), R290 (≠ I286), V291 (≠ D287), E317 (≠ F307), V318 (≠ P308), N322 (≠ E312), G335 (vs. gap), D336 (vs. gap), A337 (vs. gap), Q411 (≠ T396), M412 (≠ G397), G430 (≠ N416), G431 (vs. gap)
- binding magnesium ion: D460 (= D444), N487 (= N471), E489 (≠ M473)
- binding propyl trihydrogen diphosphate: V407 (≠ A392), G408 (= G393), Q409 (≠ N394), H410 (≠ Y395), M435 (= M419), G459 (= G443), D460 (= D444), A461 (≠ G445), S462 (≠ C446), N487 (= N471), E489 (≠ M473), Q490 (≠ Y474), G491 (= G475), M492 (≠ T476)
- binding 5-{[ethyl(methyl)amino]methyl}-2-methyl-5,6-dihydropyrimidin-4-amine: G433 (= G417), M435 (= M419), M465 (= M449)
P07342 Acetolactate synthase catalytic subunit, mitochondrial; Acetohydroxy-acid synthase catalytic subunit; AHAS; ALS; EC 2.2.1.6 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
27% identity, 95% coverage: 10:542/561 of query aligns to 93:648/687 of P07342
- R241 (= R159) binding
- 355:376 (vs. 261:282, 41% identical) binding
- 407:426 (vs. 307:323, 10% identical) binding
1t9bB Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorsulfuron (see paper)
27% identity, 95% coverage: 10:543/561 of query aligns to 9:557/595 of 1t9bB
- active site: Y29 (≠ V30), G31 (= G32), G32 (≠ E33), A33 (≠ S34), I34 (≠ F35), E55 (= E57), T78 (≠ G80), F117 (= F119), Q118 (= Q120), E119 (= E121), K167 (≠ E169), R226 (= R224), M262 (≠ Y260), V289 (≠ D287), V405 (≠ A392), L430 (vs. gap), G431 (= G417), M433 (= M419), D458 (= D444), N485 (= N471), E487 (≠ M473), Q488 (≠ Y474), M490 (≠ T476), V491 (≠ I477), W494 (≠ H480), L516 (= L502), G521 (≠ D507), L522 (≠ A508), K555 (≠ P541)
- binding 1-(2-chlorophenylsulfonyl)-3-(4-methoxy-6-methyl-l,3,5-triazin-2-yl)urea: V107 (= V109), P108 (≠ D110), D287 (= D285), R288 (≠ I286), M490 (≠ T476), W494 (≠ H480)
- binding flavin-adenine dinucleotide: R157 (= R159), G215 (= G214), A216 (≠ G215), G217 (= G216), N220 (≠ T219), T242 (≠ C240), L243 (≠ F241), Q244 (≠ R242), M259 (≠ E257), L260 (= L258), M262 (≠ Y260), H263 (≠ S261), G282 (= G280), A283 (≠ T281), R284 (= R282), D286 (≠ G284), R288 (≠ I286), V289 (≠ D287), E315 (≠ F307), V316 (≠ P308), N320 (≠ E312), G333 (vs. gap), D334 (vs. gap), A335 (vs. gap), Q409 (≠ T396), M410 (≠ G397), G428 (≠ N416), G429 (vs. gap)
- binding magnesium ion: D458 (= D444), N485 (= N471), E487 (≠ M473)
1n0hA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorimuron ethyl (see paper)
27% identity, 95% coverage: 10:542/561 of query aligns to 11:560/599 of 1n0hA
- active site: Y31 (≠ V30), G33 (= G32), G34 (≠ E33), A35 (≠ S34), I36 (≠ F35), E57 (= E57), T80 (≠ G80), F119 (= F119), Q120 (= Q120), E121 (= E121), K169 (≠ E169), R230 (= R224), M266 (≠ Y260), V293 (≠ D287), V409 (≠ A392), L434 (vs. gap), G435 (= G417), M437 (= M419), D462 (= D444), N489 (= N471), E491 (≠ M473), Q492 (≠ Y474), M494 (≠ T476), V495 (≠ I477), W498 (≠ H480), L520 (= L502), G525 (≠ D507), L526 (≠ A508), K559 (≠ P541)
- binding 4-{[(4'-amino-2'-methylpyrimidin-5'-yl)methyl]amino}pent-3-enyl diphosphate: V409 (≠ A392), G410 (= G393), Q411 (≠ N394), H412 (≠ Y395), G435 (= G417), M437 (= M419), G461 (= G443), D462 (= D444), A463 (≠ G445), S464 (≠ C446), M467 (= M449), N489 (= N471), E491 (≠ M473), Q492 (≠ Y474), G493 (= G475), V495 (≠ I477)
- binding 2-[[[[(4-chloro-6-methoxy-2-pyrimidinyl)amino]carbonyl]amino]sulfonyl]benzoic acid ethyl ester: G34 (≠ E33), A35 (≠ S34), V109 (= V109), P110 (≠ D110), F119 (= F119), K169 (≠ E169), M266 (≠ Y260), D291 (= D285), R292 (≠ I286), V495 (≠ I477), W498 (≠ H480)
- binding flavin-adenine dinucleotide: R159 (= R159), G219 (= G214), A220 (≠ G215), G221 (= G216), N224 (≠ T219), T246 (≠ C240), L247 (≠ F241), Q248 (≠ R242), L264 (= L258), G265 (= G259), M266 (≠ Y260), H267 (≠ S261), G286 (= G280), A287 (≠ T281), R288 (= R282), D290 (≠ G284), R292 (≠ I286), V293 (≠ D287), E319 (≠ F307), V320 (≠ P308), N324 (≠ E312), G337 (vs. gap), D338 (vs. gap), A339 (vs. gap), M414 (≠ G397), G432 (≠ N416), G433 (vs. gap)
- binding magnesium ion: D462 (= D444), N489 (= N471), E491 (≠ M473)
- binding thiamine diphosphate: Y31 (≠ V30), E57 (= E57), P83 (= P83)
6u9dB Saccharomyces cerevisiae acetohydroxyacid synthase (see paper)
27% identity, 95% coverage: 10:542/561 of query aligns to 13:568/607 of 6u9dB
- active site: Y33 (≠ V30), G35 (= G32), G36 (≠ E33), A37 (≠ S34), I38 (≠ F35), E59 (= E57), T82 (≠ G80), F121 (= F119), Q122 (= Q120), E123 (= E121), K171 (≠ E169), M274 (≠ Y260), V301 (≠ D287), V417 (≠ A392), G443 (= G417), M445 (= M419), D470 (= D444), N497 (= N471), E499 (≠ M473), Q500 (≠ Y474), M502 (≠ T476), V503 (≠ I477), W506 (≠ H480)
- binding methyl 2-[(4,6-dimethoxypyrimidin-2-yl)carbamoylsulfamoylmethyl]benzoate: G36 (≠ E33), V111 (= V109), P112 (≠ D110), F121 (= F119), K171 (≠ E169), D299 (= D285), R300 (≠ I286), M502 (≠ T476), W506 (≠ H480)
- binding flavin-adenine dinucleotide: R161 (= R159), A228 (≠ G215), G229 (= G216), N232 (≠ T219), T254 (≠ C240), L255 (≠ F241), Q256 (≠ R242), L272 (= L258), M274 (≠ Y260), G294 (= G280), R296 (= R282), D298 (≠ G284), R300 (≠ I286), V301 (≠ D287), E327 (≠ F307), V328 (≠ P308), N332 (≠ E312), D346 (vs. gap), A347 (vs. gap), M422 (≠ G397), G440 (≠ N416), G441 (vs. gap)
- binding magnesium ion: D470 (= D444), N497 (= N471)
- binding thiamine diphosphate: E59 (= E57), P85 (= P83), V417 (≠ A392), G418 (= G393), Q419 (≠ N394), H420 (≠ Y395), G443 (= G417), M445 (= M419), A471 (≠ G445), S472 (≠ C446), N497 (= N471), E499 (≠ M473), Q500 (≠ Y474), G501 (= G475), M502 (≠ T476), V503 (≠ I477)
5wkcA Saccharomyces cerevisiae acetohydroxyacid synthase in complex with the herbicide penoxsulam (see paper)
27% identity, 95% coverage: 10:542/561 of query aligns to 9:552/591 of 5wkcA
- active site: Y29 (≠ V30), G31 (= G32), G32 (≠ E33), A33 (≠ S34), I34 (≠ F35), E55 (= E57), T78 (≠ G80), F117 (= F119), Q118 (= Q120), E119 (= E121), K167 (≠ E169), R222 (= R224), M258 (≠ Y260), V285 (≠ D287), V401 (≠ A392), L426 (vs. gap), G427 (= G417), M429 (= M419), D454 (= D444), N481 (= N471), E483 (≠ M473), Q484 (≠ Y474), M486 (≠ T476), V487 (≠ I477), W490 (≠ H480), L512 (= L502), G517 (≠ D507), L518 (≠ A508), K551 (≠ P541)
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V401 (≠ A392), G402 (= G393), Q403 (≠ N394), H404 (≠ Y395), G427 (= G417), M429 (= M419), G453 (= G443), D454 (= D444), A455 (≠ G445), S456 (≠ C446), M459 (= M449), N481 (= N471), E483 (≠ M473), Q484 (≠ Y474), G485 (= G475), M486 (≠ T476), V487 (≠ I477)
- binding ethaneperoxoic acid: G32 (≠ E33), Q118 (= Q120)
- binding flavin-adenine dinucleotide: R157 (= R159), G211 (= G214), A212 (≠ G215), G213 (= G216), N216 (≠ T219), T238 (≠ C240), L239 (≠ F241), Q240 (≠ R242), L256 (= L258), M258 (≠ Y260), G278 (= G280), A279 (≠ T281), R280 (= R282), R284 (≠ I286), V285 (≠ D287), E311 (≠ F307), V312 (≠ P308), N316 (≠ E312), D330 (vs. gap), A331 (vs. gap), M406 (≠ G397), G424 (≠ N416)
- binding magnesium ion: D454 (= D444), N481 (= N471), E483 (≠ M473)
- binding 2-(2,2-difluoroethoxy)-N-(5,8-dimethoxy[1,2,4]triazolo[1,5-c]pyrimidin-2-yl)-6-(trifluoromethyl)benzenesulfonamide: G32 (≠ E33), A33 (≠ S34), V107 (= V109), F117 (= F119), K167 (≠ E169), M258 (≠ Y260), R284 (≠ I286), M486 (≠ T476), W490 (≠ H480)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: P30 (= P31), E55 (= E57)
7egvA Acetolactate synthase from trichoderma harzianum with inhibitor harzianic acid (see paper)
29% identity, 95% coverage: 9:542/561 of query aligns to 7:551/590 of 7egvA
- active site: Y28 (≠ V30), G30 (= G32), G31 (≠ E33), A32 (≠ S34), I33 (≠ F35), E54 (= E57), T77 (≠ G80), F116 (= F119), Q117 (= Q120), K166 (≠ E169), E220 (≠ R224), M256 (≠ Y260), V283 (≠ D287), V400 (≠ A392), L425 (vs. gap), G426 (= G417), M428 (= M419), Q483 (≠ Y474), M485 (≠ T476), V486 (≠ I477), W489 (≠ H480), L511 (= L502), G516 (≠ D507), I517 (≠ A508)
- binding flavin-adenine dinucleotide: R156 (= R159), G209 (= G214), Q210 (≠ G215), G211 (= G216), T236 (≠ C240), L237 (≠ F241), H238 (≠ R242), G276 (= G280), S277 (≠ T281), R278 (= R282), D280 (≠ G284), R282 (≠ I286), V283 (≠ D287), E309 (≠ F307), I310 (≠ P308), D328 (vs. gap), V329 (= V324), M405 (≠ G397), G423 (≠ N416), G424 (vs. gap)
- binding (2S)-3-methyl-2-[[(2S,4R)-1-methyl-4-[(2E,4E)-octa-2,4-dienoyl]-3,5-bis(oxidanylidene)pyrrolidin-2-yl]methyl]-2-oxidanyl-butanoic acid: F493 (≠ S484), Y494 (≠ H485)
- binding magnesium ion: D453 (= D444), N480 (= N471), E482 (≠ M473)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: P29 (= P31), E54 (= E57), Q117 (= Q120), V400 (≠ A392), G401 (= G393), Q402 (≠ N394), H403 (≠ Y395), G426 (= G417), M428 (= M419), D453 (= D444), A454 (≠ G445), S455 (≠ C446), E482 (≠ M473), Q483 (≠ Y474), G484 (= G475), M485 (≠ T476), V486 (≠ I477)
1jscA Crystal structure of the catalytic subunit of yeast acetohydroxyacid synthase: a target for herbicidal inhibitors (see paper)
28% identity, 95% coverage: 10:542/561 of query aligns to 11:541/541 of 1jscA
- active site: Y31 (≠ V30), G33 (= G32), G34 (≠ E33), A35 (≠ S34), I36 (≠ F35), E57 (= E57), T80 (≠ G80), F119 (= F119), Q120 (= Q120), E121 (= E121), K169 (≠ E169), M263 (≠ Y260), V290 (≠ D287), V406 (≠ A392), G432 (= G417), M434 (= M419), D459 (= D444), N486 (= N471), E488 (≠ A483), K540 (≠ P541)
- binding dihydrogenphosphate ion: G33 (= G32), G34 (≠ E33), Q120 (= Q120)
- binding flavin-adenine dinucleotide: R159 (= R159), G216 (= G214), A217 (≠ G215), G218 (= G216), N221 (≠ T219), T243 (≠ C240), L244 (≠ F241), L261 (= L258), G262 (= G259), H264 (≠ S261), G283 (= G280), A284 (≠ T281), R285 (= R282), D287 (≠ G284), R289 (≠ I286), V290 (≠ D287), E316 (≠ F307), V317 (≠ P308), N321 (≠ E312), G334 (vs. gap), D335 (vs. gap), A336 (vs. gap)
- binding magnesium ion: D459 (= D444), N486 (= N471)
- binding thiamine diphosphate: Y31 (≠ V30), P32 (= P31), E57 (= E57), P83 (= P83), V406 (≠ A392), G407 (= G393), Q408 (≠ N394), H409 (≠ Y395), M434 (= M419), D459 (= D444), A460 (≠ G445), S461 (≠ C446), N486 (= N471)
6vz8D Arabidopsis thaliana acetohydroxyacid synthase complex with valine bound (see paper)
29% identity, 94% coverage: 1:527/561 of query aligns to 2:517/531 of 6vz8D
- active site: Y32 (≠ V30), G34 (= G32), G35 (≠ E33), A36 (≠ S34), S37 (≠ F35), E58 (= E57), T81 (≠ G80), F120 (= F119), Q121 (= Q120), E122 (= E121), K170 (≠ E169), M256 (≠ Y260), V283 (≠ D287), V376 (≠ A392), G402 (= G417), M404 (= M419), D429 (= D444), N456 (= N471), H458 (≠ M473), L459 (≠ Y474), M461 (≠ T476), V462 (≠ I477), W465 (≠ H480)
- binding flavin-adenine dinucleotide: G214 (= G214), G215 (= G215), G216 (= G216), T236 (≠ C240), L237 (≠ F241), L254 (= L258), H257 (≠ S261), R278 (= R282), R282 (≠ I286), V283 (≠ D287), I291 (≠ P308), G399 (≠ A415)
- binding magnesium ion: H458 (≠ M473), L459 (≠ Y474), G460 (= G475)
- binding thiamine diphosphate: E58 (= E57), P84 (= P83), V376 (≠ A392), G377 (= G393), Q378 (≠ N394), H379 (≠ Y395), G402 (= G417), M404 (= M419), G428 (= G443), D429 (= D444), G430 (= G445), S431 (≠ C446), L459 (≠ Y474), G460 (= G475), M461 (≠ T476), V462 (≠ I477)
6lpiB Crystal structure of ahas holo-enzyme (see paper)
28% identity, 95% coverage: 10:542/561 of query aligns to 7:522/539 of 6lpiB
- active site: I27 (≠ V30), G29 (= G32), G30 (≠ E33), S31 (= S34), I32 (≠ F35), E53 (= E57), C76 (≠ G80), F115 (= F119), Q116 (= Q120), E117 (= E121), K165 (≠ E169), M256 (≠ Y260), A283 (≠ T288), V375 (≠ A392), G401 (= G417), M403 (= M419), D428 (= D444), N455 (= N471), A457 (≠ M473), L458 (≠ Y474), L460 (≠ T476), V461 (≠ I477), Q464 (≠ H480)
- binding flavin-adenine dinucleotide: R155 (= R159), G212 (= G214), G213 (= G215), G214 (= G216), T236 (≠ C240), L237 (≠ F241), M238 (≠ R242), L254 (= L258), M256 (≠ Y260), H257 (≠ S261), G276 (= G280), A277 (≠ T281), R278 (= R282), D280 (≠ G284), R282 (≠ D287), A283 (≠ T288), D300 (≠ F307), I301 (≠ P308), D319 (vs. gap), V320 (vs. gap), M380 (≠ G397), G398 (≠ N416)
- binding magnesium ion: D428 (= D444), N455 (= N471)
- binding thiamine diphosphate: E53 (= E57), C76 (≠ G80), P79 (= P83), G376 (= G393), Q377 (≠ N394), H378 (≠ Y395), G401 (= G417), M403 (= M419), G427 (= G443), D428 (= D444), G429 (= G445), S430 (≠ C446), M433 (= M449), N455 (= N471), A457 (≠ M473), L458 (≠ Y474), G459 (= G475), L460 (≠ T476), V461 (≠ I477)
6bd9A Saccharomyces cerevisiae acetohydroxyacid synthase
27% identity, 95% coverage: 10:542/561 of query aligns to 11:542/542 of 6bd9A
- active site: Y31 (≠ V30), G33 (= G32), G34 (≠ E33), A35 (≠ S34), I36 (≠ F35), E57 (= E57), T80 (≠ G80), F119 (= F119), Q120 (= Q120), E121 (= E121), K169 (≠ E169), R228 (= R224), M264 (≠ Y260), V291 (≠ D287), V407 (≠ A392), L432 (vs. gap), G433 (= G417), M435 (= M419), D460 (= D444), N487 (= N471), E489 (≠ A483), L502 (= L502), G507 (≠ D507), L508 (≠ A508), K541 (≠ P541)
- binding flavin-adenine dinucleotide: R159 (= R159), G217 (= G214), A218 (≠ G215), G219 (= G216), N222 (≠ T219), T244 (≠ C240), L245 (≠ F241), L262 (= L258), G263 (= G259), H265 (≠ S261), G284 (= G280), A285 (≠ T281), R286 (= R282), D288 (≠ G284), R290 (≠ I286), V291 (≠ D287), E317 (≠ F307), V318 (≠ P308), N322 (≠ E312), G335 (vs. gap), D336 (vs. gap), A337 (vs. gap)
- binding magnesium ion: D460 (= D444), N487 (= N471)
- binding oxygen molecule: G34 (≠ E33), T80 (≠ G80), Q120 (= Q120), A461 (≠ G445), Q494 (≠ L494)
- binding pyruvic acid: G33 (= G32), G34 (≠ E33), G34 (≠ E33), A35 (≠ S34), Q120 (= Q120)
- binding thiamine diphosphate: P32 (= P31), E57 (= E57), V407 (≠ A392), G408 (= G393), Q409 (≠ N394), H410 (≠ Y395), G433 (= G417), M435 (= M419), G459 (= G443), D460 (= D444), A461 (≠ G445), S462 (≠ C446), M465 (= M449), N487 (= N471)
6wo1A Hybrid acetohydroxyacid synthase complex structure with cryptococcus neoformans ahas catalytic subunit and saccharomyces cerevisiae ahas regulatory subunit (see paper)
27% identity, 91% coverage: 10:519/561 of query aligns to 10:504/551 of 6wo1A
- active site: Y30 (≠ V30), G32 (= G32), G33 (≠ E33), A34 (≠ S34), I35 (≠ F35), E56 (= E57), T79 (≠ G80), F118 (= F119), Q119 (= Q120), E120 (= E121), K168 (≠ E169), M255 (≠ Y260), V282 (vs. gap), V398 (≠ A392), G424 (= G417), M426 (= M419), D451 (= D444), N478 (= N471)
- binding 2-methylpyrimidin-4-amine: G424 (= G417), T425 (≠ S418), M426 (= M419)
- binding diphosphate: V398 (≠ A392), G399 (= G393), Q400 (≠ N394), H401 (≠ Y395), G450 (= G443), D451 (= D444), A452 (≠ G445), S453 (≠ C446)
- binding flavin-adenine dinucleotide: D97 (= D98), R158 (= R159), G208 (= G214), G210 (= G216), S213 (vs. gap), T235 (≠ C240), L236 (≠ F241), Q237 (≠ R242), I253 (≠ L258), G254 (= G259), M255 (≠ Y260), G275 (= G280), V276 (≠ T281), R277 (= R282), D279 (vs. gap), R281 (vs. gap), V282 (vs. gap), E308 (≠ F307), I309 (≠ P308), D327 (≠ A326), V328 (≠ M327), Q402 (≠ T396), G421 (≠ A415), G422 (≠ N416)
- binding magnesium ion: D451 (= D444), N478 (= N471)
5imsA Saccharomyces cerevisiae acetohydroxyacid synthase
27% identity, 95% coverage: 10:540/561 of query aligns to 11:540/541 of 5imsA
- active site: Y31 (≠ V30), G33 (= G32), G34 (≠ E33), A35 (≠ S34), I36 (≠ F35), E57 (= E57), T80 (≠ G80), F119 (= F119), Q120 (= Q120), E121 (= E121), K169 (≠ E169), R229 (= R224), M265 (≠ Y260), V292 (≠ D287), V408 (≠ A392), L433 (vs. gap), G434 (= G417), M436 (= M419), D461 (= D444), N488 (= N471), E490 (= E482), L502 (= L502), G507 (≠ D507), L508 (≠ A508)
- binding flavin-adenine dinucleotide: R159 (= R159), G218 (= G214), A219 (≠ G215), G220 (= G216), N223 (≠ T219), T245 (≠ C240), L246 (≠ F241), L263 (= L258), G264 (= G259), H266 (≠ S261), G285 (= G280), A286 (≠ T281), R287 (= R282), D289 (≠ G284), R291 (≠ I286), V292 (≠ D287), E318 (≠ F307), V319 (≠ P308), N323 (≠ E312), D337 (vs. gap), A338 (vs. gap)
- binding magnesium ion: D461 (= D444), N488 (= N471)
- binding oxygen molecule: G34 (≠ E33), T80 (≠ G80), Q120 (= Q120)
- binding thiamine diphosphate: P32 (= P31), E57 (= E57), V408 (≠ A392), G409 (= G393), Q410 (≠ N394), H411 (≠ Y395), G434 (= G417), M436 (= M419), G460 (= G443), D461 (= D444), A462 (≠ G445), S463 (≠ C446), M466 (= M449), N488 (= N471)
Sites not aligning to the query:
6bd3A Saccharomyces cerevisiae acetohydroxyacid synthase
27% identity, 95% coverage: 10:542/561 of query aligns to 11:538/538 of 6bd3A
- active site: Y31 (≠ V30), G33 (= G32), G34 (≠ E33), A35 (≠ S34), I36 (≠ F35), E57 (= E57), T80 (≠ G80), F119 (= F119), Q120 (= Q120), E121 (= E121), K169 (≠ E169), R225 (= R224), M261 (≠ Y260), V288 (≠ D287), V404 (≠ A392), L429 (vs. gap), G430 (= G417), M432 (= M419), D457 (= D444), N484 (= N471), L498 (= L502), G503 (≠ D507), L504 (≠ A508), K537 (≠ P541)
- binding flavin-adenine dinucleotide: R159 (= R159), G214 (= G214), A215 (≠ G215), G216 (= G216), N219 (≠ T219), T241 (≠ C240), L242 (≠ F241), Q243 (≠ R242), L259 (= L258), G260 (= G259), H262 (≠ S261), G281 (= G280), A282 (≠ T281), R283 (= R282), D285 (≠ G284), R287 (≠ I286), V288 (≠ D287), E314 (≠ F307), V315 (≠ P308), D333 (vs. gap), A334 (vs. gap)
- binding 2-acetyl-thiamine diphosphate: P32 (= P31), E57 (= E57), P83 (= P83)
- binding magnesium ion: D457 (= D444), N484 (= N471)
- binding oxygen molecule: A35 (≠ S34), T80 (≠ G80), S81 (≠ R81), Q120 (= Q120)
- binding thiamine diphosphate: V404 (≠ A392), G405 (= G393), Q406 (≠ N394), H407 (≠ Y395), G430 (= G417), M432 (= M419), D457 (= D444), A458 (≠ G445), S459 (≠ C446), M462 (= M449), N484 (= N471)
Query Sequence
>WP_011384931.1 NCBI__GCF_000009985.1:WP_011384931.1
MSQLSPAPRTGGEILADALLAQGADTVTCVPGESFLPFLDAAWDRRDRLKVLAFRHEGGA
AYAAEAHGKLTGRPGVCIVGRGPGATHASVGVHTAFQDSTPMVLLIGQVDRPIRGREAFQ
EVELAQMFRPLAKRVEEITSPDRLPEAVARAFAAAMGGRPGPAVLILPEDMLAERASVAD
VERLPPALPHPGPCRLDKMVELLAKARRPLMLVGGGGWTPEAARLITAFAEGWSLPVAAC
FRRQDIVDNESACYGGELGYSMAPSLGARVREADLILAVGTRLGDIDTAGYSLIEAPNPK
QILIHVFPEAEELGRVFRPDLAIVSAMLPFARRASQLAAPAALPWTDWTRAVRGDHLANR
VPNSCPGALDMGQVMAEIEARLPEDAIICTGAGNYTGWPQRFHRFRRYPGQLAPANGSMG
YGLPAALAAKALYPDRAVVAFAGDGCFLMTAQELATAKLHGLSPVVLVVDNGMYGTIRMH
QEASHPGRTLATDLANPDFAALAAAYDAWTARVERTEDFAPAFDQALAAGRLALLHLVLD
PEAITTRTTLTAIRDKAQNKG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory