Comparing WP_011384937.1 NCBI__GCF_000009985.1:WP_011384937.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
3uf6A The crystal structure of a possible phosphate acetyl/butaryl transferase (from listeria monocytogenes egd-e) in complex with cod (3'-dephosphocoenzyme a)
42% identity, 49% coverage: 225:454/469 of query aligns to 56:281/285 of 3uf6A
3u9eB The crystal structure of a possible phosphate acetyl/butaryl transferase (from listeria monocytogenes egd-e) in complex with coa.
42% identity, 49% coverage: 225:454/469 of query aligns to 58:283/288 of 3u9eB
1xcoD Crystal structure of a phosphotransacetylase from bacillus subtilis in complex with acetylphosphate (see paper)
28% identity, 57% coverage: 179:444/469 of query aligns to 19:311/325 of 1xcoD
Q8ZND6 Phosphate acetyltransferase; Phosphotransacetylase; EC 2.3.1.222; EC 2.3.1.8 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
33% identity, 42% coverage: 245:440/469 of query aligns to 499:692/714 of Q8ZND6
Sites not aligning to the query:
P38503 Phosphate acetyltransferase; Phosphotransacetylase; EC 2.3.1.8 from Methanosarcina thermophila (see 2 papers)
27% identity, 60% coverage: 178:460/469 of query aligns to 18:331/333 of P38503
Sites not aligning to the query:
2af3C Phosphotransacetylase from methanosarcina thermophila soaked with coenzyme a (see paper)
27% identity, 60% coverage: 178:460/469 of query aligns to 17:330/332 of 2af3C
P86397 Hydroxyacyl-thioester dehydratase type 2, mitochondrial; HsHTD2; 3-hydroxyacyl-[acyl-carrier-protein] dehydratase; EC 4.2.1.59 from Homo sapiens (Human) (see paper)
36% identity, 28% coverage: 12:141/469 of query aligns to 35:163/168 of P86397
Sites not aligning to the query:
O32472 (R)-specific enoyl-CoA hydratase; EC 4.2.1.119 from Aeromonas caviae (Aeromonas punctata) (see 2 papers)
36% identity, 28% coverage: 13:141/469 of query aligns to 6:134/134 of O32472
Sites not aligning to the query:
6ioxA Crystal structure of porphyromonas gingivalis phosphotransacetylase in complex with acetyl-coa (see paper)
28% identity, 42% coverage: 245:440/469 of query aligns to 117:317/339 of 6ioxA
A0A3Q7HWE4 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FERN, mitochondrial; 3-hydroxyl-ACP dehydratase FERN; Protein FERN-LIKE; SlFERN; EC 4.2.1.59 from Solanum lycopersicum (Tomato) (Lycopersicon esculentum) (see paper)
27% identity, 30% coverage: 13:152/469 of query aligns to 23:162/165 of A0A3Q7HWE4
6zngF Maeb full-length acetyl-coa bound state (see paper)
24% identity, 40% coverage: 242:428/469 of query aligns to 532:713/753 of 6zngF
Sites not aligning to the query:
>WP_011384937.1 NCBI__GCF_000009985.1:WP_011384937.1
MVEMMENRTFAEIKVGDTASLARTCSMKDVELFGVATGDLNPTHYSVESAEKFAHHRKVV
AHSMWGGSLLSALLGNELPGPGTLYRSQNLEFSAAVEVGDTLTVTVTVLEKIAPADIVLE
CLGANQRGETVFSGKARVAAPAEKVVQPRMELQEVALRRRHHVFEDIIARCHTLAPISVA
VCHPCDQVSLEGPVEAAKLGLIDPILIGPEAKIRSVAKEFNLDIEGLRIVDTQHSHESAE
KAVAMCRSGEAEALMKGSLHTDEMMHEVASRDKGLRTARRISHVFVMDVPTYPRTLLITD
AAINIYPTLEDKADILQNAIELAHVLGVELPKVAILSAVETVYPKINSTIEAAALCKMAD
RGQITGAQLDGPLAFDNAISEEAAKIKKINSPVAGRADILLVPDLEAGNMLAKQLSYLAD
ADAAGIVLGARVPIVLTSRADSAKARLASCAVAVLFAHARRAKSAVAAQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory