Comparing WP_011384965.1 NCBI__GCF_000009985.1:WP_011384965.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2hzlB Crystal structures of a sodium-alpha-keto acid binding subunit from a trap transporter in its closed forms (see paper)
61% identity, 90% coverage: 31:358/364 of query aligns to 2:329/337 of 2hzlB
Q3J1R2 Alpha-keto acid-binding periplasmic protein TakP; Extracytoplasmic solute receptor protein TakP; TRAP transporter alpha-keto acid-binding subunit P; TRAP-T family sorbitol/mannitol transporter, periplasmic binding protein, SmoM from Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.) (Rhodobacter sphaeroides) (see paper)
60% identity, 98% coverage: 1:358/364 of query aligns to 1:357/365 of Q3J1R2
4yicA Crystal structure of a trap transporter solute binding protein (ipr025997) from bordetella bronchiseptica rb50 (bb0280, target efi- 500035) with bound picolinic acid
56% identity, 90% coverage: 31:356/364 of query aligns to 3:328/344 of 4yicA
7ug8B Crystal structure of a solute receptor from synechococcus cc9311 in complex with alpha-ketovaleric and calcium
50% identity, 90% coverage: 30:356/364 of query aligns to 2:328/330 of 7ug8B
4petA Crystal structure of a trap periplasmic solute binding protein from colwellia psychrerythraea (cps_0129, target efi-510097) with bound calcium and pyruvate (see paper)
40% identity, 89% coverage: 34:356/364 of query aligns to 5:329/329 of 4petA
5cm6A Crystal structure of a trap periplasmic solute binding protein from pseudoalteromonas atlantica t6c(patl_2292, target efi-510180) with bound sodium and pyruvate
40% identity, 88% coverage: 34:353/364 of query aligns to 4:324/331 of 5cm6A
Q5SK82 Lactate-binding periplasmic protein TTHA0766; ABC transporter, solute-binding protein; Extracytoplasmic solute receptor protein TTHA0766; TRAP transporter lactate-binding subunit P from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
28% identity, 89% coverage: 1:325/364 of query aligns to 4:340/361 of Q5SK82
Sites not aligning to the query:
2zzwA Crystal structure of a periplasmic substrate binding protein in complex with zinc and lactate (see paper)
28% identity, 80% coverage: 34:325/364 of query aligns to 4:309/330 of 2zzwA
2zzvA Crystal structure of a periplasmic substrate binding protein in complex with calcium and lactate (see paper)
28% identity, 80% coverage: 34:325/364 of query aligns to 4:309/330 of 2zzvA
4pe3A Crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_3620, target efi-510199), apo open structure (see paper)
32% identity, 63% coverage: 35:264/364 of query aligns to 3:231/315 of 4pe3A
Sites not aligning to the query:
7e9yA Crystal structure of elacco1 (see paper)
30% identity, 49% coverage: 34:212/364 of query aligns to 4:182/563 of 7e9yA
Sites not aligning to the query:
4xf5A Crystal structure of a trap periplasmic solute binding protein from chromohalobacter salexigens dsm 3043 (csal_0678), target efi-501078, with bound (s)-(+)-2-amino-1-propanol.
24% identity, 86% coverage: 31:343/364 of query aligns to 1:308/317 of 4xf5A
4uabA Crystal structure of a trap periplasmic solute binding protein from chromohalobacter salexigens dsm 3043 (csal_0678), target efi-501078, with bound ethanolamine (see paper)
24% identity, 85% coverage: 33:343/364 of query aligns to 2:307/315 of 4uabA
6wgmA Crystal structure of a marine metagenome trap solute binding protein specific for pyroglutamate (sorcerer ii global ocean sampling expedition, unidentified microbe, scf7180008839099) in complex with co-purified pyroglutamate
26% identity, 68% coverage: 52:300/364 of query aligns to 22:265/304 of 6wgmA
4xfeA Crystal structure of a trap periplasmic solute binding protein from pseudomonas putida f1 (pput_1203), target efi-500184, with bound d- glucuronate
23% identity, 80% coverage: 33:323/364 of query aligns to 1:289/306 of 4xfeA
4p8bA Crystal structure of a trap periplasmic solute binding protein from ralstonia eutropha h16 (h16_a1328), target efi-510189, with bound (s)-2-hydroxy-2-methyl-3-oxobutanoate ((s)-2-acetolactate) (see paper)
24% identity, 79% coverage: 52:339/364 of query aligns to 21:299/314 of 4p8bA
Sites not aligning to the query:
2pfzA Crystal structure of dctp6, a bordetella pertussis extracytoplasmic solute receptor binding pyroglutamic acid (see paper)
22% identity, 66% coverage: 34:273/364 of query aligns to 2:235/301 of 2pfzA
4x8rA Crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_2138, target efi-510205) with bound glucuronate
24% identity, 67% coverage: 32:274/364 of query aligns to 3:242/304 of 4x8rA
2pfyA Crystal structure of dctp7, a bordetella pertussis extracytoplasmic solute receptor binding pyroglutamic acid (see paper)
23% identity, 60% coverage: 56:275/364 of query aligns to 24:238/301 of 2pfyA
4pdhA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_1871, target efi-510164) bound to d- erythronate (see paper)
23% identity, 67% coverage: 53:296/364 of query aligns to 21:262/301 of 4pdhA
Sites not aligning to the query:
>WP_011384965.1 NCBI__GCF_000009985.1:WP_011384965.1
MQRRKFLTGAAVGAAAASTTIAAPAIAQSMPEIKWRLASSFPKSLDTIYGAGEVLAKRVA
EATDGKFQIRVFAGGEIVPGLQVLDAVQNGTVECGHTVSYYYVGKDATFGFDASMPFGAN
TRQQNSWLYHGGGMALMREFFAKYNMLNFPCGNTGTQMGGWFRKEIKTVEDLKGLKFRIG
GYAGKVLTKLGVVPQQIAGGDLYPALEKGTIDAAEWVGPYDDEKLGFNKVAPYYYYPGWW
EGGPCVSALVNKNEWEKLPKHYKAVFEAAAAEANLDMSAKYDVLNPPALKRLIANGTQLR
PFSKDIMLACYKAAQETYAEECAANPAFKKVFDHWSAYLAEQRSWFSVAEAGFDNFMLYG
IPKK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory