SitesBLAST
Comparing WP_011384971.1 AMB_RS13035 NAD(P)-dependent oxidoreductase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
40% identity, 99% coverage: 2:246/248 of query aligns to 4:244/244 of 4nbuB
- active site: G18 (= G16), N111 (= N113), S139 (= S141), Q149 (≠ E151), Y152 (= Y154), K156 (= K158)
- binding acetoacetyl-coenzyme a: D93 (≠ I95), K98 (≠ D100), S139 (= S141), N146 (≠ S148), V147 (≠ L149), Q149 (≠ E151), Y152 (= Y154), F184 (≠ P186), M189 (≠ L191), K200 (≠ A202)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G12), N17 (≠ S15), G18 (= G16), I19 (= I17), D38 (= D36), F39 (≠ I37), V59 (≠ L61), D60 (= D62), V61 (= V63), N87 (≠ V89), A88 (= A90), G89 (= G91), I90 (≠ W92), T137 (≠ V139), S139 (= S141), Y152 (= Y154), K156 (= K158), P182 (= P184), F184 (≠ P186), T185 (= T187), T187 (= T189), M189 (≠ L191)
6qheA Alcohol dehydrogenase from arthrobacter sp. Ts-15 in complex with NAD+
36% identity, 99% coverage: 1:246/248 of query aligns to 3:256/261 of 6qheA
- binding nicotinamide-adenine-dinucleotide: G14 (= G12), M17 (≠ S15), G18 (= G16), M19 (≠ I17), D38 (= D36), R39 (vs. gap), D63 (= D62), I64 (≠ V63), A90 (≠ V89), A91 (= A90), S142 (= S141), Y156 (= Y154), K160 (= K158), P186 (= P184), G187 (= G185), M189 (≠ T187), T191 (= T189), P192 (= P190), M193 (≠ L191)
6zzsD Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and 3-oxovalerate (see paper)
37% identity, 98% coverage: 3:245/248 of query aligns to 5:259/261 of 6zzsD
- active site: G18 (= G16), S143 (= S141), Y156 (= Y154)
- binding nicotinamide-adenine-dinucleotide: G14 (= G12), S17 (= S15), I19 (= I17), D38 (= D36), M39 (≠ I37), D64 (= D62), V65 (= V63), N91 (≠ V89), A92 (= A90), G93 (= G91), M141 (≠ V139), A142 (= A140), S143 (= S141), Y156 (= Y154), K160 (= K158), P186 (= P184), G187 (= G185), V189 (≠ T187), T191 (= T189), L193 (= L191)
- binding 3-oxidanylidenepentanoic acid: Q95 (≠ G93), S143 (= S141), N145 (≠ A143), K153 (≠ E151), Y156 (= Y154), Q197 (≠ E195)
6zzqA Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and acetoacetate (see paper)
37% identity, 98% coverage: 3:245/248 of query aligns to 4:258/260 of 6zzqA
- active site: G17 (= G16), S142 (= S141), Y155 (= Y154)
- binding acetoacetic acid: Q94 (≠ G93), S142 (= S141), K152 (≠ E151), Y155 (= Y154), Q196 (≠ E195)
- binding nicotinamide-adenine-dinucleotide: G13 (= G12), S16 (= S15), G17 (= G16), I18 (= I17), D37 (= D36), M38 (≠ I37), D63 (= D62), V64 (= V63), N90 (≠ V89), A91 (= A90), G92 (= G91), M140 (≠ V139), A141 (= A140), S142 (= S141), Y155 (= Y154), K159 (= K158), Y187 (≠ P186), V188 (≠ T187), T190 (= T189)
6t77A Crystal structure of klebsiella pneumoniae fabg(NADPH-dependent) NADP- complex at 1.75 a resolution (see paper)
37% identity, 100% coverage: 1:247/248 of query aligns to 1:244/244 of 6t77A
- active site: G16 (= G16), S138 (= S141), Y151 (= Y154)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G12), S14 (≠ A14), R15 (≠ S15), T37 (≠ N38), L58 (= L61), N59 (≠ D62), V60 (= V63), A87 (= A90), G88 (= G91), I89 (≠ W92)
4nbwA Crystal structure of fabg from plesiocystis pacifica (see paper)
37% identity, 97% coverage: 6:246/248 of query aligns to 2:251/253 of 4nbwA
- active site: G12 (= G16), S146 (= S141), Y159 (= Y154), K163 (= K158)
- binding nicotinamide-adenine-dinucleotide: G8 (= G12), N11 (≠ S15), G12 (= G16), I13 (= I17), D32 (= D36), L33 (≠ I37), V57 (≠ L61), D58 (= D62), V59 (= V63), N85 (≠ V89), A86 (= A90), G87 (= G91), S146 (= S141), Y159 (= Y154), K163 (= K158), I192 (≠ T187), T194 (= T189)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
36% identity, 99% coverage: 3:247/248 of query aligns to 3:248/248 of 6ixmC
- active site: G16 (= G16), S142 (= S141), Y155 (= Y154), K159 (= K158)
- binding nicotinamide-adenine-dinucleotide: G12 (= G12), S15 (= S15), G16 (= G16), I17 (= I17), D36 (= D36), I37 (= I37), A61 (≠ L61), D62 (= D62), T63 (≠ V63), N89 (≠ V89), A90 (= A90), M140 (≠ V139), S142 (= S141), Y155 (= Y154), K159 (= K158), P185 (= P184), A186 (≠ G185), Y187 (≠ P186), I188 (≠ T187), L192 (= L191)
P0AEK2 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Escherichia coli (strain K12) (see 2 papers)
37% identity, 100% coverage: 1:247/248 of query aligns to 1:244/244 of P0AEK2
- GASR 12:15 (≠ GGAS 12:15) binding
- T37 (≠ N38) binding
- NV 59:60 (≠ DV 62:63) binding
- N86 (≠ V89) binding
- Y151 (= Y154) mutation to F: Defect in the affinity for NADPH.
- YAAAK 151:155 (≠ YSAAK 154:158) binding
- A154 (= A157) mutation to T: Decreases in the thermolability of the reductase; when associated with K-233.
- K155 (= K158) mutation to A: Defect in the affinity for NADPH.
- I184 (≠ T187) binding
- E233 (≠ Q236) mutation to K: Decreases in the thermolability of the reductase; when associated with T-154.
P0A2C9 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
37% identity, 100% coverage: 1:247/248 of query aligns to 1:244/244 of P0A2C9
- M125 (= M128) mutation to I: Loss of the temperature-sensitive phenotype; when associated with T-223.
- A223 (= A226) mutation to T: Loss of the temperature-sensitive phenotype; when associated with I-125.
- S224 (= S227) mutation to F: Distorts the local conformation and prevent stacking around Phe-221. The S224F mutation would additionally disrupt the hydrogen bond formed between Ser-224 and Glu-226.
1q7bA The structure of betaketoacyl-[acp] reductase from e. Coli in complex with NADP+ (see paper)
37% identity, 99% coverage: 2:247/248 of query aligns to 1:243/243 of 1q7bA
- active site: G15 (= G16), E101 (≠ F105), S137 (= S141), Q147 (≠ E151), Y150 (= Y154), K154 (= K158)
- binding calcium ion: E232 (≠ Q236), T233 (≠ V237)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G12), S13 (≠ A14), R14 (≠ S15), T36 (≠ N38), N58 (≠ D62), V59 (= V63), N85 (≠ V89), A86 (= A90), G87 (= G91), I88 (≠ W92), S137 (= S141), Y150 (= Y154), K154 (= K158), P180 (= P184), G181 (= G185), I183 (≠ T187)
1q7cA The structure of betaketoacyl-[acp] reductase y151f mutant in complex with NADPH fragment (see paper)
37% identity, 99% coverage: 2:247/248 of query aligns to 1:243/243 of 1q7cA
- active site: G15 (= G16), S137 (= S141), Q147 (≠ E151), F150 (≠ Y154), K154 (= K158)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G11 (= G12), S13 (≠ A14), R14 (≠ S15), A35 (≠ I37), T36 (≠ N38), L57 (= L61), N58 (≠ D62), V59 (= V63), G87 (= G91), I88 (≠ W92)
4ag3A Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with NADPH at 1.8a resolution (see paper)
37% identity, 99% coverage: 1:246/248 of query aligns to 8:253/254 of 4ag3A
- active site: G23 (= G16), S148 (= S141), Y161 (= Y154), K165 (= K158)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G19 (= G12), S21 (≠ A14), R22 (≠ S15), G23 (= G16), I24 (= I17), T44 (≠ I37), L68 (= L61), D69 (= D62), V70 (= V63), N96 (≠ V89), A97 (= A90), I146 (≠ V139), S148 (= S141), Y161 (= Y154), K165 (= K158), P191 (= P184), G192 (= G185), F193 (≠ P186), I194 (≠ T187), T196 (= T189), M198 (≠ L191), T199 (≠ L192)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
36% identity, 99% coverage: 1:245/248 of query aligns to 3:253/255 of 5itvA
- active site: G18 (= G16), S141 (= S141), Y154 (= Y154), K158 (= K158)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G12), S17 (= S15), G18 (= G16), I19 (= I17), D38 (= D36), I39 (= I37), T61 (≠ L61), I63 (≠ V63), N89 (≠ V89), G91 (= G91), T139 (≠ V139), S141 (= S141), Y154 (= Y154), K158 (= K158), P184 (= P184), G185 (= G185), I186 (≠ P186), I187 (≠ T187)
Q9KJF1 (2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase subunit BbsD; (S,R)-2-(alpha-hydroxybenzyl)succinyl-CoA dehydrogenase subunit BbsD; EC 1.1.1.429 from Thauera aromatica (see 2 papers)
35% identity, 99% coverage: 1:246/248 of query aligns to 1:245/248 of Q9KJF1
- M1 (= M1) modified: Initiator methionine, Removed
- S15 (= S15) binding
- D36 (= D36) binding
- D62 (= D62) binding
- I63 (≠ V63) binding
- N89 (≠ V89) binding
- Y153 (= Y154) binding
- K157 (= K158) binding
4bnzA Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with 1-methyl-n-phenylindole- 3-carboxamide at 2.5a resolution (see paper)
37% identity, 99% coverage: 1:246/248 of query aligns to 3:240/241 of 4bnzA
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
36% identity, 100% coverage: 1:247/248 of query aligns to 4:247/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G12), S17 (≠ A14), R18 (≠ S15), I20 (= I17), T40 (≠ N38), N62 (≠ D62), V63 (= V63), N89 (≠ V89), A90 (= A90), I92 (≠ W92), V139 (= V139), S141 (= S141), Y154 (= Y154), K158 (= K158), P184 (= P184), G185 (= G185), I187 (≠ T187), T189 (= T189), M191 (≠ L191)
7pcsB Structure of the heterotetrameric sdr family member bbscd (see paper)
35% identity, 98% coverage: 3:246/248 of query aligns to 2:244/247 of 7pcsB
- binding nicotinamide-adenine-dinucleotide: G11 (= G12), M16 (≠ I17), D35 (= D36), I36 (= I37), I62 (≠ V63), N88 (≠ V89), G90 (= G91), I138 (≠ V139), S140 (= S141), Y152 (= Y154), K156 (= K158), I185 (≠ T187)
4bnyA Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with 4-(2-phenylthieno(3,2-d) pyrimidin-4-yl)morpholine at 1.8a resolution (see paper)
36% identity, 99% coverage: 1:246/248 of query aligns to 2:238/239 of 4bnyA
4bo7A Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with n-(2,3-dihydro-1h-inden- 5-yl)tetrazolo(1,5-b)pyridazin-6-amine at 2.6a resolution (see paper)
36% identity, 99% coverage: 1:246/248 of query aligns to 3:237/238 of 4bo7A
4bnxA Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with 6-(4-(2-chloroanilino)- 1h-quinazolin-2-ylidene)cyclohexa-2, 4-dien-1-one at 2.3a resolution (see paper)
36% identity, 99% coverage: 1:246/248 of query aligns to 3:239/239 of 4bnxA
- active site: G18 (= G16), S134 (= S141), Y147 (= Y154), K151 (= K158)
- binding 6-[4-(2-chloroanilino)-1H-quinazolin-2-ylidene]cyclohexa-2,4-dien-1-one: V103 (≠ M110), N104 (≠ S111), L107 (= L114), A149 (= A156), G153 (= G160), G156 (≠ A163), F157 (= F164)
Query Sequence
>WP_011384971.1 AMB_RS13035 NAD(P)-dependent oxidoreductase
MKFEDKVALITGGASGIGYCTVKSMAELGADVLIADINVEAGEKAAAELTAKGFKAEFVR
LDVTDKANIARVKEHVVATRGRLDILCNVAGWGHIQPFVDNDDAFIAKVMSLNLTGPIEL
IRAFFPLMIEKKTGKIVNVASDAGRVGSLGESVYSAAKGGLIAFSKALAREGARFNINVN
AICPGPTDTPLLKSEPEKFLEAFLKVIPMRRFGQPQEVADSIVFMASNRADYITGQVLSV
NGGITMVG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory