SitesBLAST
Comparing WP_011384976.1 NCBI__GCF_000009985.1:WP_011384976.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6pccA Crystal structure of beta-ketoadipyl-coa thiolase mutant (h356a) in complex hexanoyl coenzyme a (see paper)
56% identity, 100% coverage: 1:398/398 of query aligns to 4:403/403 of 6pccA
- active site: C93 (= C89), A359 (≠ H354), C389 (= C384), G391 (= G386)
- binding coenzyme a: C93 (= C89), I148 (= I144), R229 (= R225), T232 (= T228), A252 (= A247), S256 (= S251), N325 (= N320), F328 (= F323)
- binding hexanal: N61 (= N57), T146 (= T142), I148 (= I144), G149 (= G145), R151 (= R147), L361 (= L356)
6pcbA Crystal structure of beta-ketoadipyl-coa thiolase mutant (h356a) in complex with coa (see paper)
56% identity, 100% coverage: 1:398/398 of query aligns to 4:403/403 of 6pcbA
- active site: C93 (= C89), A359 (≠ H354), C389 (= C384), G391 (= G386)
- binding coenzyme a: C93 (= C89), I148 (= I144), R229 (= R225), A252 (= A247), S256 (= S251), G257 (= G252), N325 (= N320), F328 (= F323)
6pcdA Crystal structure of beta-ketoadipyl-coa thiolase mutant (c90s-h356a) in complex octanoyl coenzyme a (see paper)
55% identity, 100% coverage: 1:398/398 of query aligns to 5:401/401 of 6pcdA
- active site: S94 (≠ C89), A357 (≠ H354), C387 (= C384), G389 (= G386)
- binding coenzyme a: I149 (= I144), M167 (= M162), R227 (= R225), T230 (= T228), A250 (= A247), S254 (= S251), G255 (= G252), A325 (= A322), A357 (≠ H354)
- binding octanal: N62 (= N57), T147 (= T142), T148 (= T143), I149 (= I144), G150 (= G145), R152 (= R147), L359 (= L356)
P45359 Acetyl-CoA acetyltransferase; Acetoacetyl-CoA thiolase; CaTHL; EC 2.3.1.9 from Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) (see paper)
42% identity, 100% coverage: 1:397/398 of query aligns to 1:391/392 of P45359
- V77 (= V78) mutation to Q: 3-fold increase in thiolase activity, prevents disulfide bond formation under oxidized condition and results in the loss of regulatory mechanism based on redox-switch modulation; when associated with Y-153 and K-286.
- C88 (= C89) modified: Disulfide link with 378, In inhibited form
- S96 (≠ L97) binding
- N153 (≠ G158) mutation to Y: 3-fold increase in thiolase activity, prevents disulfide bond formation under oxidized condition and results in the loss of regulatory mechanism based on redox-switch modulation; when associated with Q-77 and K-286.
- GS 279:280 (≠ AA 283:284) binding
- A286 (≠ R290) mutation to K: 3-fold increase in thiolase activity, prevents disulfide bond formation under oxidized condition and results in the loss of regulatory mechanism based on redox-switch modulation; when associated with Q-77 and Y-153.
- C378 (= C384) modified: Disulfide link with 88, In inhibited form
- A386 (= A392) binding
4xl4A Crystal structure of thiolase from clostridium acetobutylicum in complex with coa (see paper)
42% identity, 100% coverage: 1:397/398 of query aligns to 1:391/392 of 4xl4A
- active site: C88 (= C89), H348 (= H354), S378 (≠ C384), G380 (= G386)
- binding coenzyme a: L148 (vs. gap), H156 (≠ S161), R220 (= R225), L231 (= L236), A243 (= A247), S247 (= S251), F319 (= F323), H348 (= H354)
P14611 Acetyl-CoA acetyltransferase; Acetoacetyl-CoA thiolase; Beta-ketothiolase; EC 2.3.1.9 from Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) (Ralstonia eutropha) (see paper)
43% identity, 100% coverage: 1:397/398 of query aligns to 1:392/393 of P14611
- C88 (= C89) active site, Acyl-thioester intermediate; mutation to S: Almost complete loss of acetoacetyl-CoA thiolase activity.
- H156 (≠ S161) mutation to A: Almost complete loss of acetoacetyl-CoA thiolase activity.
- F219 (≠ H223) mutation to A: About 50% loss of acetoacetyl-CoA thiolase activity.; mutation to Y: 2-fold increase of acetoacetyl-CoA thiolase activity.
- R221 (= R225) mutation to A: Almost complete loss of acetoacetyl-CoA thiolase activity.
- S248 (= S251) mutation to A: About 40% loss of acetoacetyl-CoA thiolase activity.
- H349 (= H354) mutation to A: Almost complete loss of acetoacetyl-CoA thiolase activity.
- C379 (= C384) mutation to S: Almost complete loss of acetoacetyl-CoA thiolase activity.
P42765 3-ketoacyl-CoA thiolase, mitochondrial; Acetyl-CoA acetyltransferase; Acetyl-CoA acyltransferase; Acyl-CoA hydrolase, mitochondrial; Beta-ketothiolase; Mitochondrial 3-oxoacyl-CoA thiolase; T1; EC 2.3.1.16; EC 2.3.1.9; EC 3.1.2.-; EC 3.1.2.1; EC 3.1.2.2 from Homo sapiens (Human) (see paper)
40% identity, 98% coverage: 5:396/398 of query aligns to 8:394/397 of P42765
- C92 (= C89) mutation to A: Decreased acyl-CoA hydrolase activity.; mutation to S: Decreased acyl-CoA hydrolase activity; when associated with A-382.
- R224 (= R225) binding
- T227 (= T228) binding
- S251 (= S251) binding
- C382 (= C384) mutation to S: Decreased acyl-CoA hydrolase activity; when associated with S-92.
4o9cC Crystal structure of beta-ketothiolase (phaa) from ralstonia eutropha h16 (see paper)
43% identity, 100% coverage: 1:397/398 of query aligns to 1:392/393 of 4o9cC
- active site: S88 (≠ C89), H349 (= H354), C379 (= C384), G381 (= G386)
- binding coenzyme a: S88 (≠ C89), L148 (≠ F148), R221 (= R225), F236 (= F240), A244 (= A247), S248 (= S251), L250 (≠ I253), A319 (= A322), F320 (= F323), H349 (= H354)
P07097 Acetyl-CoA acetyltransferase; Acetoacetyl-CoA thiolase; Beta-ketothiolase; EC 2.3.1.9 from Shinella zoogloeoides (Crabtreella saccharophila) (see 2 papers)
43% identity, 97% coverage: 11:398/398 of query aligns to 12:392/392 of P07097
- Q64 (≠ R64) mutation to A: Slightly lower activity.
- C89 (= C89) mutation to A: Loss of activity.
- C378 (= C384) mutation to G: Loss of activity.
2vu1A Biosynthetic thiolase from z. Ramigera. Complex of with o-pantheteine- 11-pivalate. (see paper)
43% identity, 97% coverage: 11:398/398 of query aligns to 11:391/391 of 2vu1A
2vu2A Biosynthetic thiolase from z. Ramigera. Complex with s-pantetheine-11- pivalate. (see paper)
43% identity, 97% coverage: 11:398/398 of query aligns to 9:389/389 of 2vu2A
- active site: C86 (= C89), H345 (= H354), C375 (= C384), G377 (= G386)
- binding (3R)-3-hydroxy-2,2-dimethyl-4-oxo-4-({3-oxo-3-[(2-sulfanylethyl)amino]propyl}amino)butyl 2,2-dimethylpropanoate: H153 (≠ S161), M154 (= M162), F232 (= F240), S244 (= S251), G245 (= G252), F316 (= F323), H345 (= H354)
1dm3A Acetylated biosynthetic thiolase from zoogloea ramigera in complex with acetyl-coa (see paper)
43% identity, 97% coverage: 11:398/398 of query aligns to 9:389/389 of 1dm3A
- active site: C86 (= C89), H345 (= H354), C375 (= C384), G377 (= G386)
- binding acetyl coenzyme *a: C86 (= C89), L145 (≠ V153), H153 (≠ S161), M154 (= M162), R217 (= R225), S224 (≠ A232), M225 (≠ L233), A240 (= A247), S244 (= S251), M285 (= M292), A315 (= A322), F316 (= F323), H345 (= H354), C375 (= C384)
1dlvA Biosynthetic thiolase from zoogloea ramigera in complex with coa (see paper)
43% identity, 97% coverage: 11:398/398 of query aligns to 9:389/389 of 1dlvA
- active site: C86 (= C89), H345 (= H354), C375 (= C384), G377 (= G386)
- binding coenzyme a: C86 (= C89), L145 (≠ V153), H153 (≠ S161), M154 (= M162), R217 (= R225), L228 (= L236), A240 (= A247), S244 (= S251), H345 (= H354)
1ou6A Biosynthetic thiolase from zoogloea ramigera in complex with acetyl-o- pantetheine-11-pivalate
43% identity, 97% coverage: 11:398/398 of query aligns to 12:392/392 of 1ou6A
- active site: C89 (= C89), H348 (= H354), C378 (= C384), G380 (= G386)
- binding pantothenyl-aminoethanol-acetate pivalic acid: L148 (≠ V153), H156 (≠ S161), M157 (= M162), F235 (= F240), A243 (= A247), S247 (= S251), A318 (= A322), F319 (= F323), H348 (= H354)
2wkuA Biosynthetic thiolase from z. Ramigera. The n316h mutant. (see paper)
43% identity, 97% coverage: 11:398/398 of query aligns to 9:389/389 of 2wkuA
- active site: C86 (= C89), H345 (= H354), C375 (= C384), G377 (= G386)
- binding D-mannose: R38 (= R40), K182 (= K190), D194 (≠ G202), V280 (= V287), D281 (≠ P288), T287 (≠ L294), P331 (≠ D340), S332 (= S341), V334 (≠ L343), V336 (≠ P345), F360 (≠ R369)
Sites not aligning to the query:
5f38D X-ray crystal structure of a thiolase from escherichia coli at 1.8 a resolution (see paper)
43% identity, 100% coverage: 1:397/398 of query aligns to 3:394/394 of 5f38D
- active site: C90 (= C89), A348 (= A351), A378 (≠ V381), L380 (= L383)
- binding [(3~{S})-2,2-dimethyl-3-oxidanyl-4-oxidanylidene-4-[[3-oxidanylidene-3-(2-sulfanylethylamino)propyl]amino]butyl] phosphono hydrogen phosphate: C90 (= C89), L151 (≠ V153), A246 (= A247), S250 (= S251), I252 (= I253), A321 (= A322), F322 (= F323), H351 (= H354)
1m1oA Crystal structure of biosynthetic thiolase, c89a mutant, complexed with acetoacetyl-coa (see paper)
43% identity, 97% coverage: 11:398/398 of query aligns to 10:390/390 of 1m1oA
- active site: A87 (≠ C89), H346 (= H354), C376 (= C384), G378 (= G386)
- binding acetoacetyl-coenzyme a: L86 (= L88), A87 (≠ C89), L146 (≠ V153), H154 (≠ S161), M155 (= M162), R218 (= R225), S225 (≠ A232), M226 (≠ L233), A241 (= A247), G242 (= G248), S245 (= S251), A316 (= A322), F317 (= F323), H346 (= H354), I377 (= I385), G378 (= G386)
4c2jD Crystal structure of human mitochondrial 3-ketoacyl-coa thiolase in complex with coa (see paper)
40% identity, 98% coverage: 5:396/398 of query aligns to 11:393/395 of 4c2jD
5f38B X-ray crystal structure of a thiolase from escherichia coli at 1.8 a resolution (see paper)
42% identity, 100% coverage: 1:398/398 of query aligns to 1:391/391 of 5f38B
- active site: C88 (= C89), H347 (= H354), C377 (= C384), G379 (= G386)
- binding coenzyme a: C88 (= C89), L149 (≠ V153), K219 (≠ R225), F234 (= F240), A242 (= A247), S246 (= S251), A317 (= A322), F318 (= F323), H347 (= H354)
7feaB Py14 in complex with col-d (see paper)
44% identity, 99% coverage: 6:398/398 of query aligns to 7:393/396 of 7feaB
Query Sequence
>WP_011384976.1 NCBI__GCF_000009985.1:WP_011384976.1
MLDAYIYDGLRSPIGRHGGGLAPVRSDDLAAEVIRALVARSSFKPEDVEDVILGCTNQAG
EDSRNVARHAALLAGLPVEVAGQTVNRLCASGLAAVLDAARSVTCGEGDLYLAGGVESMT
RAPFVLAKGDSAWSRDARIFDTTIGARFANPKVVKSFGGHSMPETADNIAHDLGLSREAS
DAFAAASQAKYAKAKAEGFYEGEIHPITIAGRKGDTIVAEDEHPRPQTDLAALTKLKPLF
EGGVVTAGNASGINDGAAALFIGSRAAGEKAGIAPIARIVAGAAAGVPPRVMGLGPVPAI
TKALARAKLSLKDLDLIEINEAFAVQVLGCVTQLGVAADDSRLNPNGGAIAIGHPLGCSG
ARLALTAARQLQRTGGRHAVVSLCIGVGHGLAAVIERV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory