Comparing WP_011384977.1 NCBI__GCF_000009985.1:WP_011384977.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4pzeA Crystal structure of (s)-3-hydroxybutyryl-coa dehydrogenase paah1 in complex with acetoacetyl-coa (see paper)
40% identity, 55% coverage: 12:289/506 of query aligns to 5:281/283 of 4pzeA
4pzdA Crystal structure of (s)-3-hydroxybutyryl-coa dehydrogenase paah1 in complex with NAD+ (see paper)
40% identity, 55% coverage: 12:289/506 of query aligns to 5:281/283 of 4pzdA
P00348 Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial; HCDH; L-3-hydroxyacyl CoA dehydrogenase; Medium and short-chain L-3-hydroxyacyl-coenzyme A dehydrogenase; Short-chain 3-hydroxyacyl-CoA dehydrogenase; EC 1.1.1.35 from Sus scrofa (Pig) (see paper)
40% identity, 55% coverage: 14:290/506 of query aligns to 32:314/314 of P00348
1f17A L-3-hydroxyacyl-coa dehydrogenase complexed with nadh (see paper)
40% identity, 55% coverage: 14:290/506 of query aligns to 9:291/293 of 1f17A
1f12A L-3-hydroxyacyl-coa dehydrogenase complexed with 3-hydroxybutyryl-coa (see paper)
40% identity, 55% coverage: 14:290/506 of query aligns to 9:291/293 of 1f12A
1f0yA L-3-hydroxyacyl-coa dehydrogenase complexed with acetoacetyl-coa and NAD+ (see paper)
40% identity, 55% coverage: 14:290/506 of query aligns to 9:291/291 of 1f0yA
Q16836 Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial; HCDH; Medium and short-chain L-3-hydroxyacyl-coenzyme A dehydrogenase; Short-chain 3-hydroxyacyl-CoA dehydrogenase; EC 1.1.1.35 from Homo sapiens (Human) (see 7 papers)
40% identity, 55% coverage: 14:290/506 of query aligns to 32:314/314 of Q16836
6aa8E Crystal structure of (s)-3-hydroxybutyryl-coenzymea dehydrogenase from clostridium acetobutylicum complexed with NAD+ (see paper)
37% identity, 55% coverage: 14:289/506 of query aligns to 5:279/281 of 6aa8E
4kugA Crystal structure of 3-hydroxybutylryl-coa dehydrogenase with NAD from clostridium butyricum
37% identity, 55% coverage: 14:289/506 of query aligns to 6:280/282 of 4kugA
4kuhA Crystal structure of 3-hydroxybutylryl-coa dehydrogenase with acetoacetyl-coa from clostridium butyricum
37% identity, 55% coverage: 14:289/506 of query aligns to 6:280/280 of 4kuhA
P9WNP7 3-hydroxybutyryl-CoA dehydrogenase; Beta-hydroxybutyryl-CoA dehydrogenase; BHBD; EC 1.1.1.157 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
34% identity, 55% coverage: 12:289/506 of query aligns to 8:286/286 of P9WNP7
1wdlA Fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form ii (native4) (see paper)
36% identity, 48% coverage: 53:293/506 of query aligns to 358:596/715 of 1wdlA
Sites not aligning to the query:
P28793 Fatty acid oxidation complex subunit alpha; EC 4.2.1.17; EC 5.1.2.3; EC 5.3.3.8; EC 1.1.1.35 from Pseudomonas fragi (see paper)
36% identity, 48% coverage: 53:293/506 of query aligns to 358:596/715 of P28793
Sites not aligning to the query:
1wdmA Fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form i (native3) (see paper)
34% identity, 49% coverage: 53:302/506 of query aligns to 358:607/707 of 1wdmA
Sites not aligning to the query:
3zwbA Crystal structure of rat peroxisomal multifunctional enzyme type 1 (rpmfe1) complexed with 2trans-hexenoyl-coa (see paper)
32% identity, 55% coverage: 12:290/506 of query aligns to 304:587/725 of 3zwbA
Sites not aligning to the query:
5omoA Crystal structure of rat peroxisomal multifunctional enzyme type-1 (rpmfe1) complexed with with 3s-hydroxy-decanoyl-coa and 3-keto- decanoyl-coa
32% identity, 55% coverage: 12:290/506 of query aligns to 304:587/725 of 5omoA
Sites not aligning to the query:
5mgbA Crystal structure of rat peroxisomal multifunctional enzyme type-1 (rpmfe1) complexed with acetoacetyl-coa and NAD (see paper)
32% identity, 55% coverage: 12:290/506 of query aligns to 304:587/725 of 5mgbA
Sites not aligning to the query:
3zwcA Crystal structure of rat peroxisomal multifunctional enzyme type 1 (rpmfe1) complexed with 3s-hydroxy-decanoyl-coa (see paper)
32% identity, 55% coverage: 12:290/506 of query aligns to 304:587/725 of 3zwcA
Sites not aligning to the query:
2x58A The crystal structure of mfe1 liganded with coa (see paper)
32% identity, 55% coverage: 12:290/506 of query aligns to 304:587/725 of 2x58A
Sites not aligning to the query:
3zwaA Crystal structure of rat peroxisomal multifunctional enzyme type 1 (rpmfe1) complexed with 3s-hydroxy-hexanoyl-coa (see paper)
32% identity, 55% coverage: 12:290/506 of query aligns to 305:588/727 of 3zwaA
Sites not aligning to the query:
>WP_011384977.1 NCBI__GCF_000009985.1:WP_011384977.1
MSLDANRSDLILGLVGSGTMGRGIAQIAVASGVTVILVDALPGAAAKARDAVSAMLAKLA
EKGKLTAEACASATARLKLGESLADLAPCHVVVEAIVEDIKVKQALMKDLEAIVSKDCLI
ASNTSSLSVTSIAAACQHPQRVGGFHFFNPVPLMKVVEVIDGVMTAPWVVETLTALARRM
GHTPVKAKDTPGFVVNHAGRGYGTEALKLVGEGVTDFFTADRILKGAAGFRMGPFELLDL
TALDVSHPVMESIYDQYYQEPRFRPSPITRSRLVAGLLGRKTGRGFYAYEGDKAVVPPAP
PVPAAWQGPVWVAPGEGSLAVAALVTKLGASLETGEKPGETALILIPVLGEDCTTAVVRL
GLDAARSVAIDPLFGLDSHRTVMTNPVTRAEIRDGAHGLLAGDEVAVSVIADSPGLVAQR
VVATIVNIGCDIAQQRIATPDDIDKAVTLGLGYPAGPLSWGDRIGAAKVVAILDTVLAIT
GDPRYRASLWLKRRAALGVSLLTSES
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory