SitesBLAST
Comparing WP_011384980.1 NCBI__GCF_000009985.1:WP_011384980.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5ol2F The electron transferring flavoprotein/butyryl-coa dehydrogenase complex from clostridium difficile (see paper)
44% identity, 97% coverage: 10:380/383 of query aligns to 9:378/378 of 5ol2F
- active site: L124 (= L124), T125 (= T125), G241 (= G243), G374 (≠ R376)
- binding calcium ion: E29 (≠ R29), E33 (≠ D33), R35 (≠ A35)
- binding coenzyme a persulfide: L238 (= L240), R242 (= R244), E362 (= E364), G363 (= G365)
- binding flavin-adenine dinucleotide: F122 (= F122), L124 (= L124), T125 (= T125), P127 (= P127), T131 (≠ S131), F155 (= F155), I156 (= I156), T157 (= T157), E198 (≠ D199), R267 (= R269), F270 (= F272), L274 (≠ I276), F277 (= F279), Q335 (= Q337), L336 (≠ V338), G338 (= G340), G339 (= G341), Y361 (= Y363), T364 (= T366), E366 (≠ Q368)
5lnxD Crystal structure of mmgc, an acyl-coa dehydrogenase from bacillus subtilis.
43% identity, 95% coverage: 18:379/383 of query aligns to 16:373/374 of 5lnxD
- active site: L122 (= L124), T123 (= T125), G239 (= G243), E358 (= E364), K370 (≠ R376)
- binding flavin-adenine dinucleotide: L122 (= L124), T123 (= T125), G128 (= G130), S129 (= S131), F153 (= F155), T155 (= T157), R265 (= R269), Q267 (= Q271), F268 (= F272), I272 (= I276), N275 (≠ F279), I278 (≠ V282), Q331 (= Q337), I332 (≠ V338), G335 (= G341), Y357 (= Y363), T360 (= T366), E362 (≠ Q368)
4iv6B X-ray crystal structure of an isovaleryl-coa dehydrogenase from mycobacterium smegmatis (see paper)
43% identity, 96% coverage: 11:379/383 of query aligns to 9:376/383 of 4iv6B
- active site: L121 (= L124), T122 (= T125), G240 (= G243), E361 (= E364), K373 (≠ R376)
- binding dihydroflavine-adenine dinucleotide: L121 (= L124), T122 (= T125), G126 (≠ A129), G127 (= G130), S128 (= S131), W152 (≠ F155), I153 (= I156), S154 (≠ T157), R266 (= R269), S268 (≠ Q271), F269 (= F272), I273 (= I276), H276 (≠ F279), V279 (= V282), R334 (≠ Q337), V335 (= V338), G338 (= G341), L356 (= L359), G360 (≠ Y363), T363 (= T366), E365 (≠ Q368), I366 (= I369)
6fahD Molecular basis of the flavin-based electron-bifurcating caffeyl-coa reductase reaction (see paper)
43% identity, 97% coverage: 9:380/383 of query aligns to 7:378/379 of 6fahD
- active site: L124 (= L124), T125 (= T125), G241 (= G243), G374 (≠ R376)
- binding flavin-adenine dinucleotide: F122 (= F122), L124 (= L124), T125 (= T125), R152 (≠ T152), F155 (= F155), T157 (= T157), E198 (≠ D199), R267 (= R269), Q269 (= Q271), F270 (= F272), I274 (= I276), F277 (= F279), Q335 (= Q337), I336 (≠ V338), G339 (= G341), Y361 (= Y363), T364 (= T366), Q366 (= Q368)
4n5fA Crystal structure of a putative acyl-coa dehydrogenase with bound fadh2 from burkholderia cenocepacia j2315
40% identity, 96% coverage: 13:378/383 of query aligns to 15:378/378 of 4n5fA
- active site: L126 (= L124), T127 (= T125), G243 (= G243), E364 (= E364), R376 (= R376)
- binding dihydroflavine-adenine dinucleotide: L126 (= L124), T127 (= T125), G132 (= G130), S133 (= S131), F157 (= F155), T159 (= T157), T210 (= T209), Y363 (= Y363), T366 (= T366), E368 (≠ Q368), M372 (≠ L372)
4l1fA Electron transferring flavoprotein of acidaminococcus fermentans: towards a mechanism of flavin-based electron bifurcation (see paper)
41% identity, 99% coverage: 1:381/383 of query aligns to 5:380/380 of 4l1fA
- active site: L125 (= L124), T126 (= T125), G242 (= G243), E363 (= E364), R375 (= R376)
- binding coenzyme a persulfide: T132 (≠ S131), H179 (≠ G179), F232 (= F233), M236 (= M237), E237 (≠ K238), L239 (= L240), D240 (= D241), R243 (= R244), Y362 (= Y363), E363 (= E364), G364 (= G365), R375 (= R376)
- binding flavin-adenine dinucleotide: F123 (= F122), L125 (= L124), T126 (= T125), G131 (= G130), T132 (≠ S131), F156 (= F155), I157 (= I156), T158 (= T157), R268 (= R269), Q270 (= Q271), F271 (= F272), I275 (= I276), F278 (= F279), L281 (≠ V282), Q336 (= Q337), I337 (≠ V338), G340 (= G341), I358 (≠ L359), Y362 (= Y363), T365 (= T366), Q367 (= Q368)
- binding 1,3-propandiol: L5 (≠ M1), Q10 (≠ E6)
1ukwB Crystal structure of medium-chain acyl-coa dehydrogenase from thermus thermophilus hb8
40% identity, 97% coverage: 10:379/383 of query aligns to 11:377/379 of 1ukwB
- active site: L124 (= L124), S125 (≠ T125), T241 (≠ G243), E362 (= E364), R374 (= R376)
- binding cobalt (ii) ion: D145 (= D145), H146 (= H146)
- binding flavin-adenine dinucleotide: F122 (= F122), L124 (= L124), S125 (≠ T125), G130 (= G130), S131 (= S131), W155 (≠ F155), S157 (≠ T157), K200 (= K201), L357 (= L359), Y361 (= Y363), E362 (= E364), T364 (= T366), E366 (≠ Q368), L370 (= L372)
1ukwA Crystal structure of medium-chain acyl-coa dehydrogenase from thermus thermophilus hb8
40% identity, 97% coverage: 10:379/383 of query aligns to 11:377/379 of 1ukwA
- active site: L124 (= L124), S125 (≠ T125), T241 (≠ G243), E362 (= E364), R374 (= R376)
- binding flavin-adenine dinucleotide: F122 (= F122), L124 (= L124), S125 (≠ T125), G130 (= G130), S131 (= S131), W155 (≠ F155), S157 (≠ T157), L357 (= L359), Y361 (= Y363), E362 (= E364), T364 (= T366), E366 (≠ Q368), L370 (= L372)
8pheA Acad9-wt in complex with ecsit-cter (see paper)
42% identity, 96% coverage: 8:375/383 of query aligns to 30:400/551 of 8pheA
- binding : L143 (= L124), D151 (= D132), A153 (= A134), S154 (= S135), I155 (≠ L136), K202 (≠ A178), I205 (= I181), F256 (= F233), M260 (= M237), F295 (= F272), N296 (≠ G273), I394 (= I369), Y398 (≠ V373)
Sites not aligning to the query:
Q9H845 Complex I assembly factor ACAD9, mitochondrial; Acyl-CoA dehydrogenase family member 9; ACAD-9; EC 1.3.8.- from Homo sapiens (Human) (see 4 papers)
42% identity, 96% coverage: 8:375/383 of query aligns to 67:437/621 of Q9H845
- R193 (= R137) to W: in MC1DN20; uncertain significance; dbSNP:rs377547811
- S234 (≠ P173) to F: in MC1DN20; uncertain significance
- G303 (= G243) to S: in MC1DN20; uncertain significance; dbSNP:rs143383023
- A326 (= A266) to T: in MC1DN20; uncertain significance; dbSNP:rs115532916
- E413 (= E351) to K: in MC1DN20; uncertain significance; dbSNP:rs149753643
- E426 (= E364) mutation to Q: Loss of long-chain-acyl-CoA dehydrogenase activity. Does not affect mitochondrial complex I assembly.
Sites not aligning to the query:
- 1:37 modified: transit peptide, Mitochondrion
8phfA Cryo-em structure of human acad9-s191a (see paper)
42% identity, 96% coverage: 8:375/383 of query aligns to 30:400/547 of 8phfA
- binding flavin-adenine dinucleotide: T144 (= T125), W176 (≠ F155), K225 (= K201), R292 (= R269), Q294 (= Q271), F295 (= F272), F302 (= F279), L304 (= L281), I305 (≠ V282), I363 (≠ V338), G365 (= G340), G366 (= G341), F388 (≠ Y363), E393 (≠ Q368), M397 (≠ L372)
Sites not aligning to the query:
2z1qB Crystal structure of acyl coa dehydrogenase
40% identity, 98% coverage: 6:380/383 of query aligns to 26:410/549 of 2z1qB
- active site: L144 (= L124), T145 (= T125), G259 (= G243), E394 (= E364), G406 (≠ R376)
- binding flavin-adenine dinucleotide: Y142 (≠ F122), L144 (= L124), T145 (= T125), G150 (= G130), S151 (= S131), W177 (≠ F155), S179 (≠ T157), R285 (= R269), F288 (= F272), I292 (= I276), F295 (= F279), I298 (≠ V282), H369 (= H339), G370 (= G340), F393 (≠ Y363), I399 (= I369)
Sites not aligning to the query:
4m9aB Crystal structure of acyl-coa dehydrogenase from burkholderia thailandensis e264
39% identity, 96% coverage: 11:378/383 of query aligns to 11:376/376 of 4m9aB
- active site: L124 (= L124), T125 (= T125), G241 (= G243), E362 (= E364), R374 (= R376)
- binding dihydroflavine-adenine dinucleotide: F122 (= F122), T125 (= T125), G130 (= G130), S131 (= S131), F155 (= F155), T157 (= T157), T208 (= T209), Y361 (= Y363), T364 (= T366), E366 (≠ Q368), M370 (≠ L372)
7y0bA Crystal structure of human short-chain acyl-coa dehydrogenase
40% identity, 98% coverage: 6:381/383 of query aligns to 9:382/385 of 7y0bA
- binding (2S,3R,4R,5S,6R)-2-[4-chloranyl-3-[[4-[(3S)-oxolan-3-yl]oxyphenyl]methyl]phenyl]-6-(hydroxymethyl)oxane-3,4,5-triol: M343 (≠ A342), T347 (≠ S346), E348 (≠ D347)
- binding flavin-adenine dinucleotide: F125 (= F122), L127 (= L124), S128 (≠ T125), G133 (= G130), S134 (= S131), W158 (≠ F155), T160 (= T157), R270 (= R269), F273 (= F272), L280 (≠ F279), V282 (≠ L281), Q338 (= Q337), I339 (≠ V338), G342 (= G341), I360 (≠ L359), Y364 (= Y363), T367 (= T366), E369 (≠ Q368), I370 (= I369), L373 (= L372)
7y0aC Crystal structure of human short-chain acyl-coa dehydrogenase
40% identity, 98% coverage: 6:381/383 of query aligns to 12:385/387 of 7y0aC
- binding flavin-adenine dinucleotide: F128 (= F122), L130 (= L124), S131 (≠ T125), G136 (= G130), S137 (= S131), W161 (≠ F155), T163 (= T157), T214 (= T209), R273 (= R269), F276 (= F272), L280 (≠ I276), L283 (≠ F279), V285 (≠ L281), Q341 (= Q337), I342 (≠ V338), G345 (= G341), I363 (≠ L359), Y367 (= Y363), T370 (= T366), E372 (≠ Q368), L376 (= L372)
P16219 Short-chain specific acyl-CoA dehydrogenase, mitochondrial; SCAD; Butyryl-CoA dehydrogenase; EC 1.3.8.1 from Homo sapiens (Human) (see 3 papers)
40% identity, 98% coverage: 6:381/383 of query aligns to 36:409/412 of P16219
- G90 (= G60) to S: in ACADSD; loss of acyl-CoA dehydrogenase activity; dbSNP:rs121908005
- E104 (= E74) natural variant: Missing (in ACADSD; loss of acyl-CoA dehydrogenase activity; dbSNP:rs387906308)
- 152:161 (vs. 122:131, 70% identical) binding in other chain
- R171 (= R141) to W: 69% of wild-type acyl-CoA dehydrogenase activity; confers susceptibility to ethylmalonicaciduria; dbSNP:rs1800556
- WIT 185:187 (≠ FIT 155:157) binding in other chain
- A192 (= A162) to V: in ACADSD; loss of acyl-CoA dehydrogenase activity; dbSNP:rs28940874
- G209 (= G177) to S: 86% of wild-type acyl-CoA dehydrogenase activity; confers susceptibility to ethylmalonicaciduria; dbSNP:rs1799958
- R297 (= R269) binding
- Q308 (= Q280) binding in other chain
- R325 (= R297) to W: in ACADSD; loss of acyl-CoA dehydrogenase activity; dbSNP:rs121908006
- S353 (= S325) to L: in ACADSD; loss of acyl-CoA dehydrogenase activity; dbSNP:rs28941773
- QILGG 365:369 (≠ QVHGG 337:341) binding
- R380 (= R352) to W: in ACADSD; loss of acyl-CoA dehydrogenase activity; dbSNP:rs28940875
- TSE 394:396 (≠ TTQ 366:368) binding in other chain
Sites not aligning to the query:
- 1:24 modified: transit peptide, Mitochondrion
8sgsA Short-chain specific acyl-CoA dehydrogenase, mitochondrial (see paper)
40% identity, 98% coverage: 6:381/383 of query aligns to 6:379/381 of 8sgsA
- binding coenzyme a: S131 (= S131), A133 (= A133), N177 (= N175), F231 (= F233), M235 (= M237), L238 (= L240), I312 (≠ S314), E362 (= E364), G363 (= G365)
- binding flavin-adenine dinucleotide: F122 (= F122), L124 (= L124), S125 (≠ T125), G130 (= G130), S131 (= S131), W155 (≠ F155), T157 (= T157), R267 (= R269), F270 (= F272), L274 (≠ I276), L277 (≠ F279), Q335 (= Q337), I336 (≠ V338), G338 (= G340), G339 (= G341), I357 (≠ L359), I360 (= I362), Y361 (= Y363), T364 (= T366), E366 (≠ Q368)
3pfdC Crystal structure of an acyl-coa dehydrogenase from mycobacterium thermoresistibile bound to reduced flavin adenine dinucleotide solved by combined iodide ion sad mr (see paper)
40% identity, 97% coverage: 11:380/383 of query aligns to 4:369/369 of 3pfdC
- active site: L116 (= L124), S117 (≠ T125), T233 (≠ G243), E353 (= E364), R365 (= R376)
- binding dihydroflavine-adenine dinucleotide: Y114 (≠ F122), L116 (= L124), S117 (≠ T125), G122 (= G130), S123 (= S131), W147 (≠ F155), I148 (= I156), T149 (= T157), R259 (= R269), F262 (= F272), V266 (≠ I276), N269 (≠ F279), Q326 (= Q337), L327 (≠ V338), G330 (= G341), I348 (≠ L359), Y352 (= Y363), T355 (= T366), Q357 (= Q368)
7w0jE Acyl-coa dehydrogenase, tfu_1647
39% identity, 99% coverage: 1:380/383 of query aligns to 4:382/382 of 7w0jE
- binding [[(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] [(2R,3S,4S)-5-azanyl-2,3,4-tris(oxidanyl)pentyl] hydrogen phosphate: S127 (≠ T125), W157 (≠ F155), R270 (= R269), Q272 (= Q271), F273 (= F272), I277 (= I276), F280 (= F279), I283 (≠ V282), Q339 (= Q337), L340 (≠ V338), G343 (= G341), Y365 (= Y363), E366 (= E364), T368 (= T366), Q370 (= Q368), I371 (= I369)
8i4rA Crystal structure of acyl-coa dehydrogenase complexed with acetyl-coa from thermobifida fusca
39% identity, 99% coverage: 1:380/383 of query aligns to 3:381/381 of 8i4rA
- binding acetyl coenzyme *a: S132 (= S131), T134 (≠ A133), R180 (≠ G179), R234 (≠ K234), L237 (≠ M237), R238 (≠ K238), L240 (= L240), D241 (= D241), R244 (= R244), E365 (= E364), G366 (= G365), R377 (= R376)
- binding flavin-adenine dinucleotide: Y123 (≠ F122), L125 (= L124), S126 (≠ T125), G131 (= G130), S132 (= S131), W156 (≠ F155), I157 (= I156), T158 (= T157), I360 (≠ L359), T367 (= T366), Q369 (= Q368)
Query Sequence
>WP_011384980.1 NCBI__GCF_000009985.1:WP_011384980.1
MIRDQEILNQLLDTLSRFVRERLVPNEERIAEDDALPAEIIAEMKDLGLFGLSIPEEYGG
LGLTMEEEVLCAFEIGQTSPAFRSIFGTNNGIGSQGIIIDGTEEQKQKYLPRLATGELIA
SFALTEPNAGSDAASLRTTARKDGDHYIVNGTKRFITNAPEASIFTLMARTDPNNKGAGG
ISAFIVEADSPGLSLGKIDKKMGQKGAHTCDVIFEDVRVPAANIIGGIEGQGFKTAMKVL
DRGRLHISATCVGVSERLIRDSVKYAAERVQFGKPIGEFQLVQAMLADSRTEAYAARCMV
LDAARKKDQGINVSTEAACCKMFASEAVGRIADRAVQVHGGAGYISDYGIERFYRDVRLF
RIYEGTTQIQQLVIARNMLKDIA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory