Comparing WP_011385005.1 NCBI__GCF_000009985.1:WP_011385005.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9I6J1 Putrescine-binding periplasmic protein SpuD from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
53% identity, 100% coverage: 2:369/369 of query aligns to 4:367/367 of Q9I6J1
3ttmA Crystal structure of spud in complex with putrescine (see paper)
54% identity, 93% coverage: 27:368/369 of query aligns to 1:341/341 of 3ttmA
Q9I6J0 Spermidine-binding periplasmic protein SpuE from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
50% identity, 97% coverage: 12:369/369 of query aligns to 10:365/365 of Q9I6J0
3ttnA Crystal structures of polyamine receptors spud and spue from pseudomonas aeruginosa (see paper)
51% identity, 91% coverage: 31:366/369 of query aligns to 2:335/335 of 3ttnA
P31133 Putrescine-binding periplasmic protein PotF from Escherichia coli (strain K12) (see 3 papers)
48% identity, 97% coverage: 12:369/369 of query aligns to 12:370/370 of P31133
Sites not aligning to the query:
6ye7A E.Coli's putrescine receptor potf complexed with cadaverine (see paper)
49% identity, 92% coverage: 29:368/369 of query aligns to 2:341/341 of 6ye7A
6ye6A E.Coli's putrescine receptor potf complexed with agmatine (see paper)
49% identity, 92% coverage: 29:368/369 of query aligns to 2:341/341 of 6ye6A
6ye0B E.Coli's putrescine receptor potf complexed with putrescine (see paper)
49% identity, 92% coverage: 29:368/369 of query aligns to 2:341/341 of 6ye0B
1a99A Putrescine receptor (potf) from e. Coli (see paper)
49% identity, 92% coverage: 29:368/369 of query aligns to 2:341/341 of 1a99A
7oyxB E.Coli's putrescine receptor variant potf/d (4jdf) with mutations e39d y87s f88y s247d in complex with spermidine (see paper)
48% identity, 92% coverage: 29:369/369 of query aligns to 2:342/347 of 7oyxB
7oywA E.Coli's putrescine receptor variant potf/d (4jdf) with mutations e39d f88l s247d in complex with spermidine (see paper)
47% identity, 92% coverage: 29:369/369 of query aligns to 2:342/348 of 7oywA
7oyvA E.Coli's putrescine receptor variant potf/d (4jdf) with mutations e39d f88a s247d in complex with spermidine (see paper)
47% identity, 92% coverage: 29:368/369 of query aligns to 2:341/341 of 7oyvA
Sites not aligning to the query:
7xjnA Structure of vcpotd1 in complex with norspermidine
36% identity, 85% coverage: 27:340/369 of query aligns to 1:295/322 of 7xjnA
Sites not aligning to the query:
P0AFK9 Spermidine/putrescine-binding periplasmic protein; SPBP from Escherichia coli (strain K12) (see 3 papers)
35% identity, 87% coverage: 20:340/369 of query aligns to 18:320/348 of P0AFK9
Sites not aligning to the query:
1poy1 Spermidine/putrescine-binding protein complexed with spermidine (dimer form) (see paper)
35% identity, 85% coverage: 28:340/369 of query aligns to 1:295/323 of 1poy1
Sites not aligning to the query:
4eqbA 1.5 angstrom crystal structure of spermidine/putrescine abc transporter substrate-binding protein potd from streptococcus pneumoniae strain canada mdr_19a in complex with calcium and hepes
30% identity, 85% coverage: 31:344/369 of query aligns to 4:297/323 of 4eqbA
Sites not aligning to the query:
6hlyA Structure in p212121 form of the pbp agtb in complex with agropinic acid from a.Tumefacien r10 (see paper)
25% identity, 81% coverage: 45:344/369 of query aligns to 24:290/320 of 6hlyA
Sites not aligning to the query:
4r75A Structure of the periplasmic binding protein afua from actinobacillus pleuropneumoniae (exogenous sedoheptulose-7-phosphate bound) (see paper)
25% identity, 67% coverage: 111:358/369 of query aligns to 80:306/318 of 4r75A
Sites not aligning to the query:
4r73A Structure of the periplasmic binding protein afua from actinobacillus pleuropneumoniae (endogenous glucose-6-phosphate and mannose-6- phosphate bound) (see paper)
25% identity, 67% coverage: 111:358/369 of query aligns to 82:308/321 of 4r73A
Sites not aligning to the query:
4r74B Structure of the periplasmic binding protein afua from actinobacillus pleuropneumoniae (exogenous fructose-6-phosphate bound) (see paper)
25% identity, 67% coverage: 111:358/369 of query aligns to 82:308/320 of 4r74B
Sites not aligning to the query:
>WP_011385005.1 NCBI__GCF_000009985.1:WP_011385005.1
MRISFTAVAVSLIAAAVSSVSGAQAAEDKVLNVYNWSDYIAPDTLEKFTALTGIKVNYDV
YDSNEVLQAKLQAGKSGYDVVFPSASPFLANQIKAGIYRKLDRSKLSNYGNLDAQVMVTL
NRAADPGNLYAIPYAISPTGFAYNVDKVAKAGKDMPLDSWAALFDPAQVAKLKGCGVSLL
DAPTEVFPAALTYLGKNGASLDSADLKAAAEAVTKVRPSIKYFHSSKFINDLANGDICMA
HGYVGDLVQSRNRAAEAGKGVNIKIVIPKEGAVINIDSMVIPADAPHPENAHKFIDFMMK
QEVAAGFSNTTGYGNPIPGSRSLIRKEIQEDPVIFPSEQVTAKLYQVPPADMAKERERTR
LWTTVKTGR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory