Comparing WP_011385082.1 NCBI__GCF_000009985.1:WP_011385082.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 16 hits to proteins with known functional sites (download)
O31618 Thiazole synthase; EC 2.8.1.10 from Bacillus subtilis (strain 168) (see 2 papers)
53% identity, 77% coverage: 73:323/324 of query aligns to 4:254/256 of O31618
1tygA Structure of the thiazole synthase/this complex (see paper)
54% identity, 74% coverage: 73:313/324 of query aligns to 2:242/242 of 1tygA
5z9yB Crystal structure of mycobacterium tuberculosis thiazole synthase (thig) complexed with dxp (see paper)
49% identity, 75% coverage: 73:315/324 of query aligns to 2:233/234 of 5z9yB
4n6fA Crystal structure of amycolatopsis orientalis bexx complexed with g6p (see paper)
34% identity, 73% coverage: 73:310/324 of query aligns to 5:241/242 of 4n6fA
Q9WYU4 Pyridoxal 5'-phosphate synthase subunit PdxS; PLP synthase subunit PdxS; Pdx1; EC 4.3.3.6 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
36% identity, 35% coverage: 210:323/324 of query aligns to 167:279/293 of Q9WYU4
Sites not aligning to the query:
2issB Structure of the plp synthase holoenzyme from thermotoga maritima (see paper)
39% identity, 27% coverage: 210:296/324 of query aligns to 172:261/285 of 2issB
Sites not aligning to the query:
Q8L940 Pyridoxal 5'-phosphate synthase subunit PDX1.3; AtPDX1.3; AtPDX1;1; PLP synthase subunit PDX1.3; EC 4.3.3.6 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
46% identity, 17% coverage: 243:296/324 of query aligns to 216:271/309 of Q8L940
Sites not aligning to the query:
5k2zB Pdx1.3-adduct (arabidopsis) (see paper)
46% identity, 17% coverage: 243:296/324 of query aligns to 197:252/278 of 5k2zB
Sites not aligning to the query:
5lnsA Crystal structure of arabidopsis thaliana pdx1-r5p complex (see paper)
46% identity, 17% coverage: 243:296/324 of query aligns to 196:251/275 of 5lnsA
Sites not aligning to the query:
5lnrA Crystal structure of arabidopsis thaliana pdx1-plp complex (see paper)
48% identity, 15% coverage: 247:296/324 of query aligns to 200:251/267 of 5lnrA
Sites not aligning to the query:
5lnwA Crystal structure of arabidopsis thaliana pdx1-i320-g3p complex (see paper)
46% identity, 17% coverage: 243:296/324 of query aligns to 196:251/274 of 5lnwA
Sites not aligning to the query:
5lnuA Crystal structure of arabidopsis thaliana pdx1-i320 complex (see paper)
46% identity, 17% coverage: 243:296/324 of query aligns to 196:251/277 of 5lnuA
Sites not aligning to the query:
Q03148 Pyridoxal 5'-phosphate synthase subunit SNZ1; PLP synthase subunit SNZ1; PDX1 homolog 1; Pdx1.1; p35; EC 4.3.3.6 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
42% identity, 17% coverage: 239:292/324 of query aligns to 193:251/297 of Q03148
Sites not aligning to the query:
3o05A Crystal structure of yeast pyridoxal 5-phosphate synthase snz1 complxed with substrate plp (see paper)
42% identity, 17% coverage: 239:292/324 of query aligns to 179:237/261 of 3o05A
Sites not aligning to the query:
5lntA Crystal structure of arabidopsis thaliana pdx1k166r-prei320 complex (see paper)
41% identity, 17% coverage: 243:296/324 of query aligns to 197:252/273 of 5lntA
Sites not aligning to the query:
O14027 Probable pyridoxal 5'-phosphate synthase subunit PDX1; PLP synthase subunit PDX1; EC 4.3.3.6 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
50% identity, 13% coverage: 255:296/324 of query aligns to 216:257/296 of O14027
Sites not aligning to the query:
>WP_011385082.1 NCBI__GCF_000009985.1:WP_011385082.1
MKLVINGEERNFSASMTVEALLGELGVDSRKVAVERNLEIVPKSSYAQVAVNDGDKLEIV
AFIGGGSDQADSFTVAGKTFNSRLLVGTGKYKDFEETALAIEASGAEIVTVAVRRVNLSD
PSKPMLVDYVSPKKYTFLPNTAGCYTADDSVRTLRLAREAGGWNLVKLEVLGDQTTLYPN
MPETLKAAEALIKDGFEVMVYCSDDPIQAKMLEDMGCVAIMPLGSLIGSGLGILNPTTIR
IIKDTVKVPVLVDAGVGTASDAALAMELGCDGVLMNTAIAHAKDPIRMARAMKLAIEAGR
LSYLAGRMPKKSYADPSSPTSGLI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory