Comparing WP_011385114.1 NCBI__GCF_000009985.1:WP_011385114.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 19 hits to proteins with known functional sites (download)
Q9AI65 Alpha-glucosidase; EC 3.2.1.20 from Erwinia rhapontici (Pectobacterium rhapontici) (see paper)
32% identity, 98% coverage: 5:421/425 of query aligns to 3:449/453 of Q9AI65
Sites not aligning to the query:
5c3mB Crystal structure of gan4c, a gh4 6-phospho-glucosidase from geobacillus stearothermophilus
30% identity, 91% coverage: 36:421/425 of query aligns to 34:407/411 of 5c3mB
P39130 Alpha-galacturonidase; EC 3.2.1.67 from Bacillus subtilis (strain 168) (see paper)
26% identity, 94% coverage: 6:405/425 of query aligns to 11:432/446 of P39130
3fefA Crystal structure of putative glucosidase lpld from bacillus subtilis
26% identity, 94% coverage: 6:405/425 of query aligns to 5:426/434 of 3fefA
Q97LM4 Maltose-6'-phosphate glucosidase MalH; 6-phospho-alpha-glucosidase; 6-phospho-glucosidase; Maltose-6-phosphate hydrolase; EC 3.2.1.122 from Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) (see paper)
27% identity, 92% coverage: 29:420/425 of query aligns to 28:436/441 of Q97LM4
1u8xX Crystal structure of glva from bacillus subtilis, a metal-requiring, NAD-dependent 6-phospho-alpha-glucosidase (see paper)
26% identity, 91% coverage: 36:420/425 of query aligns to 35:428/436 of 1u8xX
Sites not aligning to the query:
P54716 Maltose-6'-phosphate glucosidase; 6-phospho-alpha-D-glucosidase; 6-phosphoryl-O-alpha-D-glucopyranosyl:phosphoglucohydrolase; EC 3.2.1.122 from Bacillus subtilis (strain 168) (see paper)
26% identity, 91% coverage: 36:420/425 of query aligns to 37:437/449 of P54716
O33830 Alpha-glucosidase; Maltase; EC 3.2.1.20 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
24% identity, 99% coverage: 5:423/425 of query aligns to 4:480/480 of O33830
1obbA Alpha-glucosidase a, agla, from thermotoga maritima in complex with maltose and NAD+ (see paper)
24% identity, 96% coverage: 5:413/425 of query aligns to 3:463/478 of 1obbA
6dvvA 2.25 angstrom resolution crystal structure of 6-phospho-alpha- glucosidase from klebsiella pneumoniae in complex with NAD and mn2+. (see paper)
26% identity, 88% coverage: 47:420/425 of query aligns to 43:430/435 of 6dvvA
Sites not aligning to the query:
6vc6B 2.1 angstrom resolution crystal structure of 6-phospho-alpha- glucosidase from gut microorganisms in complex with NAD and mn2+
25% identity, 88% coverage: 44:418/425 of query aligns to 32:433/440 of 6vc6B
Sites not aligning to the query:
6wbtA 2.52 angstrom resolution crystal structure of 6-phospho-alpha- glucosidase from gut microorganisms in complex with NAD and glucose- 6-phosphate
25% identity, 98% coverage: 6:420/425 of query aligns to 5:437/442 of 6wbtA
7br4A Structure of deletion mutant of alpha-glucuronidase (tm0752) from thermotoga maritima (see paper)
24% identity, 97% coverage: 6:416/425 of query aligns to 3:457/468 of 7br4A
6kcxA Crystal structure of citrate complex of alpha-glucuronidase (tm0752) from thermotoga maritima (see paper)
24% identity, 97% coverage: 6:416/425 of query aligns to 3:458/470 of 6kcxA
1vjtA Crystal structure of alpha-glucosidase (tm0752) from thermotoga maritima at 2.50 a resolution
24% identity, 97% coverage: 6:416/425 of query aligns to 4:459/471 of 1vjtA
7ctmA Crystal structure of thermotoga maritima alpha-glucuronidase (tm0752) in complex with nadh and d-glucuronic acid (see paper)
24% identity, 97% coverage: 6:416/425 of query aligns to 3:458/469 of 7ctmA
3u95A Crystal structure of a putative alpha-glucosidase from thermotoga neapolitana (see paper)
24% identity, 96% coverage: 6:413/425 of query aligns to 2:454/468 of 3u95A
1up6A Structure of the 6-phospho-beta glucosidase from thermotoga maritima at 2.55 angstrom resolution in the tetragonal form with manganese, NAD+ and glucose-6-phosphate (see paper)
26% identity, 82% coverage: 74:422/425 of query aligns to 64:411/413 of 1up6A
Sites not aligning to the query:
1up7A Structure of the 6-phospho-beta glucosidase from thermotoga maritima at 2.4 angstrom resolution in the tetragonal form with NAD and glucose-6-phosphate (see paper)
26% identity, 82% coverage: 74:422/425 of query aligns to 65:412/414 of 1up7A
Sites not aligning to the query:
>WP_011385114.1 NCBI__GCF_000009985.1:WP_011385114.1
MKNITKIAFLGAGSMSFGLSTFRDMFSSDTLAGSTLVLVDHNPEALARMKALAERMNAEG
KAGMIIESTTDRREAFDGASVVINSVAIDRMRLWKHDFEIPKKYGIRQTLGENGGPGGLF
FTMRTLPLIFEITRDMEELCPDALFLNFSNPESRIVLALGKYSPIKSMGLCHGIFMARGA
ICHITGVPWHDAECWGIGLNHFQWMLQVRNRWTGEDMYPLLRAKEPGFDPTFQPFSRKMF
NIYGLWPSCSDDHMGEYLAFGWEGGEHGHDYAGDARERVELQEAIEGVLAGGPLPDEWKH
SVGERTNVVVDGLINNRHHYLESAVLMNNGTIPNLPPDLAVEVPAIVDAAGVHPVSLGPL
PESIQKLALVQAGVQQLSVEAAVHASKELALQALLADPVVNSSDAAVKLLDELWEINKPY
IRKCV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory