Comparing WP_011385145.1 NCBI__GCF_000009985.1:WP_011385145.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
47% identity, 92% coverage: 16:222/224 of query aligns to 16:220/226 of 5xu1B
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
44% identity, 97% coverage: 5:222/224 of query aligns to 2:223/232 of 1f3oA
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
44% identity, 97% coverage: 5:222/224 of query aligns to 2:223/230 of 1l2tA
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
47% identity, 96% coverage: 10:223/224 of query aligns to 12:224/233 of P75957
7mdyC Lolcde nucleotide-bound
47% identity, 96% coverage: 10:223/224 of query aligns to 9:221/226 of 7mdyC
7arlD Lolcde in complex with lipoprotein and adp (see paper)
47% identity, 96% coverage: 10:223/224 of query aligns to 9:221/222 of 7arlD
7v8iD Lolcd(e171q)e with bound amppnp in nanodiscs (see paper)
46% identity, 96% coverage: 10:223/224 of query aligns to 11:223/229 of 7v8iD
2pclA Crystal structure of abc transporter with complex (aq_297) from aquifex aeolicus vf5
45% identity, 91% coverage: 22:224/224 of query aligns to 18:218/223 of 2pclA
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
44% identity, 98% coverage: 5:223/224 of query aligns to 4:221/592 of 5lj7A
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
44% identity, 98% coverage: 5:223/224 of query aligns to 4:221/615 of 5lilA
5ws4A Crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii (see paper)
43% identity, 98% coverage: 5:223/224 of query aligns to 5:222/650 of 5ws4A
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
45% identity, 98% coverage: 5:223/224 of query aligns to 5:222/648 of P75831
8g4cB Bceabs atpgs high res tm (see paper)
33% identity, 98% coverage: 3:222/224 of query aligns to 2:221/248 of 8g4cB
7tchB Bceab e169q variant atp-bound conformation (see paper)
33% identity, 98% coverage: 3:222/224 of query aligns to 1:220/245 of 7tchB
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
37% identity, 90% coverage: 22:223/224 of query aligns to 16:215/240 of 4ymuJ
Sites not aligning to the query:
8tzjA Cryo-em structure of vibrio cholerae ftse/ftsx complex (see paper)
39% identity, 87% coverage: 23:217/224 of query aligns to 19:210/220 of 8tzjA
Sites not aligning to the query:
8w6iD Cryo-em structure of escherichia coli str k12 ftsex complex with atp- gamma-s in peptidisc
41% identity, 86% coverage: 33:224/224 of query aligns to 28:217/219 of 8w6iD
Sites not aligning to the query:
P0A9R7 Cell division ATP-binding protein FtsE from Escherichia coli (strain K12) (see paper)
41% identity, 86% coverage: 33:224/224 of query aligns to 28:217/222 of P0A9R7
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
41% identity, 92% coverage: 19:223/224 of query aligns to 14:215/241 of 4u00A
Sites not aligning to the query:
P9WQK5 Uncharacterized ABC transporter ATP-binding protein Rv0073 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
43% identity, 87% coverage: 23:217/224 of query aligns to 23:215/330 of P9WQK5
>WP_011385145.1 NCBI__GCF_000009985.1:WP_011385145.1
MEVAIEARGVTRDLPGPVPVTLVRDIDLTVGRGEFVAVTGPSGSGKSSLLYLLGLLDVPT
GGSVWLQGGNTAGLPPDAMAELRLASIGFVFQFHFLLPEFTCQSNVEIPIRRLGALSDSQ
ARIRAAELLDSLELADHRRKYPDQLSGGQRQRVAIARALANDPPLILADEPTGNLDTRTA
HLVFELFRDLAHRQNRTVIVVTHDAELAQTADRRVHLVDGRIVG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory