SitesBLAST
Comparing WP_011385159.1 NCBI__GCF_000009985.1:WP_011385159.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7arcG Cryo-em structure of polytomella complex-i (peripheral arm) (see paper)
55% identity, 97% coverage: 3:673/690 of query aligns to 7:678/682 of 7arcG
- binding fe2/s2 (inorganic) cluster: R36 (= R32), C38 (= C34), Y39 (= Y35), G47 (= G43), C49 (= C45), R50 (= R46), C52 (= C48), C66 (= C62)
- binding iron/sulfur cluster: H98 (= H94), D101 (= D97), C102 (= C98), C105 (= C101), Q107 (= Q103), C111 (= C107), Q114 (= Q110), C150 (= C146), I151 (= I147), C153 (= C149), C156 (= C152), C200 (= C196), V202 (= V198), A204 (= A200), L205 (= L201)
- binding : K272 (= K268), Q274 (= Q270), R275 (= R271), N277 (≠ D273), G539 (= G542), L579 (≠ P582)
7qsoG Bovine complex i in lipid nanodisc, state 3 (slack) (see paper)
54% identity, 98% coverage: 6:678/690 of query aligns to 9:690/700 of 7qsoG
- binding fe2/s2 (inorganic) cluster: R35 (= R32), C37 (= C34), Y38 (= Y35), G46 (= G43), C48 (= C45), R49 (= R46), C51 (= C48), C65 (= C62)
- binding iron/sulfur cluster: H97 (= H94), D100 (= D97), C101 (= C98), C104 (= C101), Q106 (= Q103), G107 (= G104), C110 (= C107), Q113 (= Q110), C149 (= C146), I150 (= I147), Q151 (= Q148), C152 (= C149), T153 (= T150), R154 (= R151), C155 (= C152), C199 (= C196), P200 (= P197), V201 (= V198), G202 (= G199), A203 (= A200)
7v2cM Active state complex i from q10 dataset (see paper)
53% identity, 98% coverage: 6:678/690 of query aligns to 8:689/690 of 7v2cM
- binding fe2/s2 (inorganic) cluster: C36 (= C34), Y37 (= Y35), G45 (= G43), C47 (= C45), R48 (= R46), C50 (= C48), C64 (= C62)
- binding magnesium ion: Q105 (= Q103), C198 (= C196), V200 (= V198)
- binding iron/sulfur cluster: H96 (= H94), D99 (= D97), C100 (= C98), C103 (= C101), Q105 (= Q103), C109 (= C107), Q112 (= Q110), C148 (= C146), C151 (= C149), T152 (= T150), R153 (= R151), C154 (= C152), C198 (= C196), V200 (= V198), A202 (= A200), L203 (= L201)
5gupG structure of mammalian respiratory supercomplex I1III2IV1 (see paper)
53% identity, 97% coverage: 6:674/690 of query aligns to 7:670/673 of 5gupG
- binding fe2/s2 (inorganic) cluster: C35 (= C34), Y36 (= Y35), N45 (= N44), C46 (= C45), C49 (= C48), C63 (= C62)
- binding iron/sulfur cluster: H95 (= H94), C99 (= C98), C102 (= C101), Q104 (= Q103), C108 (= C107), Q111 (= Q110), R146 (= R145), C147 (= C146), I148 (= I147), C150 (= C149), T151 (= T150), C153 (= C152), V177 (≠ I176), C197 (= C196), P198 (= P197), A201 (= A200), L202 (= L201)
- binding : K269 (= K268), R270 (= R269), Q271 (= Q270), R272 (= R271), R279 (= R278), L284 (≠ K282), L285 (= L283), Y287 (≠ P285)
8eszS1 NADH-ubiquinone oxidoreductase chain 1 (see paper)
55% identity, 97% coverage: 3:674/690 of query aligns to 5:671/683 of 8eszS1
- binding fe2/s2 (inorganic) cluster: C36 (= C34), Y37 (= Y35), A44 (= A42), G45 (= G43), C47 (= C45), R48 (= R46), C50 (= C48), C64 (= C62)
- binding iron/sulfur cluster: H96 (= H94), D99 (= D97), C100 (= C98), C103 (= C101), C109 (= C107), Q112 (= Q110), C152 (= C146), I153 (= I147), H154 (≠ Q148), C155 (= C149), T156 (= T150), R157 (= R151), C158 (= C152), I182 (= I176), C202 (= C196), P203 (= P197), V204 (= V198)
7b0nG 3.7-angstrom structure of Yarrowia lipolytica complex I with an R121M mutation in NUCM. (see paper)
51% identity, 99% coverage: 3:686/690 of query aligns to 4:690/694 of 7b0nG
- binding fe2/s2 (inorganic) cluster: C35 (= C34), G44 (= G43), C46 (= C45), R47 (= R46), C49 (= C48), C63 (= C62)
- binding iron/sulfur cluster: H95 (= H94), C99 (= C98), C102 (= C101), C108 (= C107), Q111 (= Q110), C149 (= C146), H151 (≠ Q148), C152 (= C149), T153 (= T150), C155 (= C152), C199 (= C196), V201 (= V198)
7zm7A Cryoem structure of mitochondrial complex i from chaetomium thermophilum (inhibited by ddm) (see paper)
53% identity, 97% coverage: 3:674/690 of query aligns to 4:683/711 of 7zm7A
- binding fe2/s2 (inorganic) cluster: R33 (= R32), C35 (= C34), Y36 (= Y35), G44 (= G43), C46 (= C45), R47 (= R46), C49 (= C48), C63 (= C62)
- binding iron/sulfur cluster: H95 (= H94), D98 (= D97), C99 (= C98), C102 (= C101), Q104 (= Q103), G105 (= G104), C108 (= C107), Q111 (= Q110), C149 (= C146), I150 (= I147), C152 (= C149), T153 (= T150), C155 (= C152), I179 (= I176), C199 (= C196), V201 (= V198), L204 (= L201)
8gyms1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial (see paper)
50% identity, 98% coverage: 3:676/690 of query aligns to 5:677/689 of 8gyms1
- binding fe2/s2 (inorganic) cluster: R34 (= R32), C36 (= C34), Y37 (= Y35), C47 (= C45), C50 (= C48), C64 (= C62)
- binding iron/sulfur cluster: H96 (= H94), C100 (= C98), C103 (= C101), Q105 (= Q103), G106 (= G104), C109 (= C107), Q112 (= Q110), R147 (= R145), C148 (= C146), I149 (= I147), H150 (≠ Q148), C151 (= C149), T152 (= T150), R153 (= R151), C154 (= C152), C198 (= C196), P199 (= P197), V200 (= V198), G201 (= G199), A202 (= A200)
8bedG Cryo-em structure of the arabidopsis thaliana i+iii2 supercomplex (ci peripheral tip) (see paper)
50% identity, 98% coverage: 3:675/690 of query aligns to 19:686/687 of 8bedG
- binding fe2/s2 (inorganic) cluster: R48 (= R32), C50 (= C34), Y51 (= Y35), G59 (= G43), C61 (= C45), R62 (= R46), C64 (= C48), C78 (= C62)
- binding iron/sulfur cluster: H110 (= H94), D113 (= D97), C114 (= C98), C117 (= C101), Q119 (= Q103), G120 (= G104), C123 (= C107), L125 (= L109), Q126 (= Q110), C162 (= C146), I163 (= I147), Q164 (= Q148), C165 (= C149), T166 (= T150), C168 (= C152), I192 (= I176), C212 (= C196), V214 (= V198), A216 (= A200), L217 (= L201)
- binding : I116 (= I100), F224 (≠ Y208), W305 (= W288), R306 (≠ N289), P589 (≠ F580), T590 (≠ P581), R595 (≠ K586), D596 (≠ E587), K599 (≠ R590), I600 (= I591), R602 (= R593), A603 (= A594), E606 (= E597)
6x89S1 radiata mitochondrial complex I* (see paper)
50% identity, 98% coverage: 3:675/690 of query aligns to 20:687/688 of 6x89S1
- binding fe2/s2 (inorganic) cluster: C51 (= C34), G60 (= G43), C62 (= C45), R63 (= R46), C65 (= C48), C79 (= C62)
- binding iron/sulfur cluster: H111 (= H94), C115 (= C98), C118 (= C101), C124 (= C107), L126 (= L109), R162 (= R145), C163 (= C146), I164 (= I147), Q165 (= Q148), C166 (= C149), C169 (= C152), C213 (= C196), P214 (= P197), V215 (= V198), V215 (= V198), G216 (= G199)
- binding : W306 (= W288), R307 (≠ N289), P590 (≠ F580), T591 (≠ P581), R596 (≠ K586), D597 (≠ E587), K600 (≠ R590), R603 (= R593), A604 (= A594), E607 (= E597), R612 (≠ A602)
7a23C Plant mitochondrial respiratory complex i (see paper)
50% identity, 98% coverage: 3:675/690 of query aligns to 26:693/693 of 7a23C
- binding fe2/s2 (inorganic) cluster: R55 (= R32), C57 (= C34), Y58 (= Y35), C68 (= C45), C71 (= C48), C85 (= C62)
- binding iron/sulfur cluster: H117 (= H94), D120 (= D97), C121 (= C98), C124 (= C101), G127 (= G104), C130 (= C107), L132 (= L109), Q133 (= Q110), C169 (= C146), I170 (= I147), Q171 (= Q148), C172 (= C149), T173 (= T150), R174 (= R151), C175 (= C152), I199 (= I176), C219 (= C196), P220 (= P197), V221 (= V198), G222 (= G199)
P29915 NADH-quinone oxidoreductase chain 3; NADH dehydrogenase I, chain 3; NDH-1, chain 3; EC 7.1.1.- from Paracoccus denitrificans (see 2 papers)
52% identity, 97% coverage: 3:672/690 of query aligns to 6:658/673 of P29915
- H106 (= H94) mutation to A: Very little incorporation of iron-sulfur centers into protein in E.coli.; mutation to C: Alters the EPR signal of the N5 cluster; all 3 iron-sulfur clusters are less stable in E.coli.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
5lc5G Structure of mammalian respiratory complex i, class2 (see paper)
65% identity, 29% coverage: 3:202/690 of query aligns to 3:202/685 of 5lc5G
- binding fe2/s2 (inorganic) cluster: R32 (= R32), C34 (= C34), G43 (= G43), C45 (= C45), C48 (= C48), C62 (= C62)
- binding iron/sulfur cluster: H94 (= H94), D97 (= D97), C98 (= C98), C101 (= C101), C107 (= C107), Q110 (= Q110), C146 (= C146), I147 (= I147), C149 (= C149), C152 (= C152), C196 (= C196), G199 (= G199)
3i9vC Crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus, oxidized, 2 mol/asu (see paper)
33% identity, 91% coverage: 1:629/690 of query aligns to 1:654/754 of 3i9vC
- active site: A270 (≠ R259), A353 (= A341), A354 (≠ V347), A486 (≠ Q444), P514 (≠ A482), A515 (= A483)
- binding calcium ion: D142 (= D132), H145 (≠ Y135)
- binding fe2/s2 (inorganic) cluster: C34 (= C34), S35 (≠ Y35), G43 (= G43), A44 (≠ N44), C45 (= C45), R46 (= R46), C48 (= C48), C66 (= C62)
- binding manganese (ii) ion: L251 (≠ V240), D279 (≠ K268)
- binding iron/sulfur cluster: H98 (= H94), D101 (= D97), C102 (= C98), C105 (= C101), K107 (≠ Q103), C111 (= C107), L113 (= L109), Q114 (= Q110), C158 (= C146), I159 (= I147), C161 (= C149), C164 (= C152), F179 (≠ G167), I188 (= I176), C207 (= C196), P208 (= P197), V209 (= V198), A211 (= A200), C233 (≠ D222), L235 (≠ M224), C236 (≠ D225), V238 (≠ L227), G239 (= G228), C240 (≠ S229), C268 (≠ S257), G271 (≠ S260), P384 (= P378)
3i9v3 Crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus, oxidized, 2 mol/asu (see paper)
33% identity, 91% coverage: 1:629/690 of query aligns to 1:654/754 of 3i9v3
- active site: A353 (= A341), A354 (≠ V347), A486 (≠ Q444), P514 (≠ A482), A515 (= A483)
- binding fe2/s2 (inorganic) cluster: C34 (= C34), S35 (≠ Y35), G43 (= G43), C45 (= C45), R46 (= R46), C48 (= C48), C66 (= C62)
- binding manganese (ii) ion: L251 (≠ V240), D279 (≠ K268)
- binding iron/sulfur cluster: H98 (= H94), D101 (= D97), C102 (= C98), C105 (= C101), C111 (= C107), Q114 (= Q110), C158 (= C146), I159 (= I147), C161 (= C149), C164 (= C152), F179 (≠ G167), I188 (= I176), C207 (= C196), P208 (= P197), V209 (= V198), A211 (= A200), C233 (≠ D222), C236 (≠ D225), V238 (≠ L227), G239 (= G228), C240 (≠ S229), C268 (≠ S257), G271 (≠ S260), P384 (= P378)
2ybb3 Fitted model for bovine mitochondrial supercomplex i1iii2iv1 by single particle cryo-em (emd-1876) (see paper)
33% identity, 91% coverage: 1:629/690 of query aligns to 1:654/754 of 2ybb3
- active site: A353 (= A341), A354 (≠ V347), A486 (≠ Q444), P514 (≠ A482), A515 (= A483)
- binding fe2/s2 (inorganic) cluster: C34 (= C34), S35 (≠ Y35), G43 (= G43), C45 (= C45), R46 (= R46), C48 (= C48), C66 (= C62)
- binding magnesium ion: L251 (≠ V240), D279 (≠ K268)
- binding iron/sulfur cluster: H98 (= H94), C102 (= C98), C105 (= C101), K107 (≠ Q103), C111 (= C107), Q114 (= Q110), C158 (= C146), H160 (≠ Q148), C161 (= C149), C164 (= C152), C207 (= C196), P208 (= P197), V209 (= V198), L212 (= L201), C233 (≠ D222), C236 (≠ D225), V238 (≠ L227), C240 (≠ S229), I267 (≠ L256), C268 (≠ S257), P384 (= P378), I385 (≠ V379)
4hea3 Crystal structure of the entire respiratory complex i from thermus thermophilus (see paper)
33% identity, 91% coverage: 1:629/690 of query aligns to 1:656/756 of 4hea3
- active site: A355 (= A341), A356 (≠ V347), A488 (≠ Q444), P516 (≠ A482), A517 (= A483)
- binding fe2/s2 (inorganic) cluster: C34 (= C34), S35 (≠ Y35), G43 (= G43), C45 (= C45), R46 (= R46), C48 (= C48), C66 (= C62)
- binding iron/sulfur cluster: H98 (= H94), D101 (= D97), C102 (= C98), C105 (= C101), C111 (= C107), Q114 (= Q110), R159 (= R145), C160 (= C146), I161 (= I147), C163 (= C149), R165 (= R151), C166 (= C152), F181 (≠ G167), C209 (= C196), P210 (= P197), V211 (= V198), A213 (= A200), L214 (= L201), C235 (≠ D222), L237 (≠ M224), C238 (≠ D225), V240 (≠ L227), G241 (= G228), C242 (≠ S229), C270 (≠ S257), G273 (≠ S260), I387 (≠ V379)
Q56223 NADH-quinone oxidoreductase subunit 3; NADH dehydrogenase I chain 3; NDH-1 subunit 3; EC 7.1.1.- from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see 2 papers)
32% identity, 91% coverage: 1:629/690 of query aligns to 1:677/783 of Q56223
- C34 (= C34) binding
- C45 (= C45) binding
- C48 (= C48) binding
- C83 (= C62) binding
- H115 (= H94) binding
- C181 (= C146) binding
- C184 (= C149) binding
- C187 (= C152) binding
- C230 (= C196) binding
- C256 (≠ D222) binding ; mutation to A: Decreases amount and stability of iron-sulfur center 4.
- C259 (≠ D225) binding ; mutation to A: Decreases amount and stability of iron-sulfur center 4.
- C263 (≠ S229) binding ; mutation to A: Decreases amount and stability of iron-sulfur center 4.
- C291 (≠ S257) binding ; mutation to A: Decreases amount and stability of iron-sulfur center 4.
8e9hG Mycobacterial respiratory complex i, fully-inserted quinone (see paper)
33% identity, 89% coverage: 1:617/690 of query aligns to 4:656/782 of 8e9hG
- binding fe2/s2 (inorganic) cluster: R35 (= R32), C37 (= C34), D38 (≠ Y35), G46 (= G43), C48 (= C45), R49 (= R46), C51 (= C48), A63 (= A60), C65 (= C62)
- binding guanosine-5'-triphosphate: R320 (≠ Q313), R486 (= R460), R487 (≠ K461), G554 (= G521), E556 (≠ D523), D559 (= D526), L579 (≠ Q538), E580 (≠ G539), R582 (≠ H541), D627 (= D588)
- binding iron/sulfur cluster: H99 (= H94), D102 (= D97), C103 (= C98), C106 (= C101), G109 (= G104), C112 (= C107), Q115 (= Q110), C152 (= C146), V153 (≠ I147), L154 (≠ Q148), C155 (= C149), A156 (≠ T150), R157 (= R151), C158 (= C152), C202 (= C196), P203 (= P197), V204 (= V198), A206 (= A200), L207 (= L201), C228 (≠ D222), C231 (≠ D225), S233 (≠ L227), C235 (≠ S229), N262 (≠ L256), C263 (≠ S257), G266 (≠ S260), P391 (= P378), I392 (≠ V379)
Sites not aligning to the query:
7nyrG Respiratory complex i from escherichia coli - conformation 1 (see paper)
30% identity, 54% coverage: 1:372/690 of query aligns to 1:381/907 of 7nyrG
- binding fe2/s2 (inorganic) cluster: C34 (= C34), W35 (≠ Y35), C45 (= C45), R46 (= R46), C48 (= C48), M65 (≠ A60), C67 (= C62)
- binding iron/sulfur cluster: H99 (= H94), D102 (= D97), C103 (= C98), C106 (= C101), G109 (= G104), C112 (= C107), Q115 (= Q110), C151 (= C146), I152 (= I147), A153 (≠ Q148), C154 (= C149), Y155 (≠ T150), C157 (= C152), F181 (≠ I176), C201 (= C196), G204 (= G199), V205 (≠ A200), F206 (≠ L201), C228 (≠ D222), C231 (≠ D225), I233 (≠ L227), C235 (≠ S229), C263 (≠ S257), G266 (≠ S260)
Sites not aligning to the query:
Query Sequence
>WP_011385159.1 NCBI__GCF_000009985.1:WP_011385159.1
MPKLTIDGREIEVEAGTTIIQAADLLGIEIPRFCYHERLAIAGNCRMCLVEVEKMPKPAA
SCAMPVGEGMVVKTNTPAVRKARQGVMEFLLLNHPLDCPICDQGGECDLQDQAMAYGSDK
NRCKEGKRAVPDKDYGPLVQTMMTRCIQCTRCVRFISEIAGTPVLGGLGRGEHLEIGRYV
GAAVSSELSGNLIDLCPVGALTNKPASYTYRSWELKKTESIDAMDALGSAIRVDTRGNEV
IRILPRVAEDVNEEWLSDRSRFACDGLKRQRLDKPYVRKDGKLVPATWNEAFVAIAAKVK
AAGTKIAAIAGDQADAETMVAYKDLLAALGSQAIDCRQDGAKLDASVRASYLFNSTAAGI
EEADALLIIGSNPRKENPVLNARIRKRWQKGGFKVARIGHKGDLTYKYEHLGDDASILKA
IAEGSHPFFEVLKNAKKPALILGQGALSRADGAVILGLARKLADAAGLVKDGWNGFNVLH
TAAARVGGLDLGFVPGQGWRDVDHIVDGAHKGDVQVVFLVGADEVDMKALGEAFVVYQGS
HGDAGAHRADVILPGAAYTEKSATFVNLEGRAQQTRLAVFPPGEAKEDWRIVRALSEVLG
KALPYDSLKAVRERLAKASPVFAAIGSVTPAAWGAAFGAEGSLGDGALVSNIDNFYQTDP
ISRASKTMAECTAAFGGGCNHKHKKTGTHG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory