SitesBLAST
Comparing WP_011385160.1 NCBI__GCF_000009985.1:WP_011385160.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7aqrF Cryo-em structure of arabidopsis thaliana complex-i (peripheral arm) (see paper)
74% identity, 96% coverage: 2:409/427 of query aligns to 8:415/434 of 7aqrF
- binding flavin mononucleotide: G60 (= G54), R61 (= R55), G62 (= G56), K71 (= K65), N89 (= N83), D91 (= D85), Y177 (= Y171), G180 (= G174), E181 (= E175), E182 (= E176), T216 (≠ N210), N217 (= N211)
- binding iron/sulfur cluster: S351 (= S345), C352 (= C346), G353 (= G347), Q354 (= Q348), C355 (= C349), C358 (= C352), T396 (= T390), C398 (= C392), L400 (= L394)
7arcF Cryo-em structure of polytomella complex-i (peripheral arm) (see paper)
72% identity, 97% coverage: 2:417/427 of query aligns to 9:424/430 of 7arcF
- binding flavin mononucleotide: G61 (= G54), R62 (= R55), K72 (= K65), N90 (= N83), D92 (= D85), E93 (= E86), S94 (≠ G87), Y178 (= Y171), G181 (= G174), E182 (= E175), T217 (≠ N210), N218 (= N211), L401 (= L394)
- binding iron/sulfur cluster: S352 (= S345), C353 (= C346), G354 (= G347), Q355 (= Q348), C356 (= C349), C359 (= C352), T397 (= T390), C399 (= C392), L401 (= L394)
Q91YT0 NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial; NDUFV1; Complex I-51kD; CI-51kD; NADH-ubiquinone oxidoreductase 51 kDa subunit; EC 7.1.1.2 from Mus musculus (Mouse) (see 2 papers)
72% identity, 97% coverage: 2:417/427 of query aligns to 35:450/464 of Q91YT0
- C379 (= C346) binding
- C382 (= C349) binding
- C385 (= C352) binding
- C425 (= C392) binding
Sites not aligning to the query:
- 1:20 modified: transit peptide, Mitochondrion
8b9zF Drosophila melanogaster complex i in the active state (dm1) (see paper)
71% identity, 97% coverage: 2:417/427 of query aligns to 17:432/441 of 8b9zF
- binding flavin mononucleotide: G69 (= G54), G71 (= G56), K80 (= K65), N98 (= N83), D100 (= D85), G189 (= G174), E191 (= E176), N226 (= N211), A408 (= A393), L409 (= L394)
- binding iron/sulfur cluster: P205 (= P190), C361 (= C346), G362 (= G347), Q363 (= Q348), C364 (= C349), C367 (= C352), T405 (= T390), C407 (= C392), L409 (= L394)
5lnk1 Entire ovine respiratory complex i (see paper)
72% identity, 97% coverage: 2:417/427 of query aligns to 9:424/432 of 5lnk1
- binding fe2/s2 (inorganic) cluster: P96 (= P89), G97 (= G90)
- binding flavin mononucleotide: G61 (= G54), R62 (= R55), K72 (= K65), N90 (= N83), D92 (= D85), E93 (= E86), G94 (= G87), Y178 (= Y171), G181 (= G174), E182 (= E175), V216 (= V209), A217 (≠ N210), N218 (= N211), T221 (≠ S214), L401 (= L394)
- binding iron/sulfur cluster: P197 (= P190), S352 (= S345), C353 (= C346), Q355 (= Q348), C356 (= C349), C359 (= C352), T397 (= T390), I398 (= I391), C399 (= C392)
6zk91 Peripheral domain of open complex i during turnover (see paper)
72% identity, 97% coverage: 2:417/427 of query aligns to 7:422/430 of 6zk91
- binding flavin mononucleotide: G59 (= G54), G61 (= G56), K70 (= K65), N88 (= N83), D90 (= D85), E91 (= E86), G179 (= G174), E180 (= E175), A215 (≠ N210), N216 (= N211), A398 (= A393), L399 (= L394)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G61 (= G56), G62 (= G57), A63 (= A58), F65 (= F60), K70 (= K65), E93 (= E88), Y176 (= Y171), E181 (= E176), F201 (= F196), T323 (= T318)
- binding iron/sulfur cluster: I177 (= I172), P195 (= P190), C351 (= C346), G352 (= G347), Q353 (= Q348), C354 (= C349), C357 (= C352), T395 (= T390), C397 (= C392), L399 (= L394)
8eswV1 NADH dehydrogenase (Ubiquinone) 24 kDa subunit, isoform A (see paper)
71% identity, 97% coverage: 2:417/427 of query aligns to 15:430/439 of 8eswV1
- binding flavin mononucleotide: G67 (= G54), G69 (= G56), K78 (= K65), N96 (= N83), D98 (= D85), E99 (= E86), G187 (= G174), E188 (= E175), N224 (= N211), A406 (= A393)
- binding iron/sulfur cluster: I185 (= I172), P203 (= P190), C359 (= C346), Q361 (= Q348), C362 (= C349), C365 (= C352), T403 (= T390), I404 (= I391), C405 (= C392), L407 (= L394)
- binding : Y143 (≠ V130), N144 (≠ R131), Q150 (≠ N137), D174 (≠ E161)
P25708 NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial; NDUFV1; Complex I-51kD; CI-51kD; NADH dehydrogenase flavoprotein 1; NADH-ubiquinone oxidoreductase 51 kDa subunit; EC 7.1.1.2 from Bos taurus (Bovine) (see paper)
72% identity, 97% coverage: 2:417/427 of query aligns to 35:450/464 of P25708
- C379 (= C346) binding
- C382 (= C349) binding
- C385 (= C352) binding
- C425 (= C392) binding
7dgq8 NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial (see paper)
72% identity, 97% coverage: 2:417/427 of query aligns to 4:419/427 of 7dgq8
- binding flavin mononucleotide: G58 (= G56), K67 (= K65), N85 (= N83), D87 (= D85), E88 (= E86), G89 (= G87), C175 (= C173), G176 (= G174), A212 (≠ N210), N213 (= N211)
- binding iron/sulfur cluster: S347 (= S345), C348 (= C346), G349 (= G347), C351 (= C349), C354 (= C352), C394 (= C392), L396 (= L394)
- binding : R121 (≠ H119), Y132 (≠ V130), Q139 (≠ N137), R143 (≠ D141), Y146 (≠ R144), E147 (≠ A145), F165 (≠ Y163), R168 (= R166)
P49821 NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial; NDUFV1; Complex I-51kD; CI-51kD; NADH dehydrogenase flavoprotein 1; NADH-ubiquinone oxidoreductase 51 kDa subunit; EC 7.1.1.2 from Homo sapiens (Human) (see paper)
71% identity, 97% coverage: 2:417/427 of query aligns to 35:450/464 of P49821
- C379 (= C346) binding
- C382 (= C349) binding
- C385 (= C352) binding
- C425 (= C392) binding
7v2cA Active state complex i from q10 dataset (see paper)
72% identity, 97% coverage: 2:417/427 of query aligns to 10:425/433 of 7v2cA
- binding flavin mononucleotide: G62 (= G54), K73 (= K65), N91 (= N83), Y179 (= Y171), G182 (= G174), E183 (= E175), N219 (= N211), A401 (= A393), L402 (= L394)
- binding iron/sulfur cluster: P198 (= P190), C354 (= C346), G355 (= G347), Q356 (= Q348), C357 (= C349), C360 (= C352), T398 (= T390), C400 (= C392), L402 (= L394)
8gymv1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial (see paper)
69% identity, 99% coverage: 2:423/427 of query aligns to 6:428/442 of 8gymv1
- binding flavin mononucleotide: G58 (= G54), G60 (= G56), N88 (= N83), D90 (= D85), Y176 (= Y171), E180 (= E175), E181 (= E176), T215 (≠ N210), N216 (= N211), T219 (≠ S214), A398 (= A393), L399 (= L394)
- binding iron/sulfur cluster: I177 (= I172), P195 (= P190), C351 (= C346), G352 (= G347), Q353 (= Q348), C354 (= C349), C357 (= C352), T395 (= T390), C397 (= C392), L399 (= L394), G400 (= G395)
7zm7B Cryoem structure of mitochondrial complex i from chaetomium thermophilum (inhibited by ddm) (see paper)
68% identity, 97% coverage: 2:417/427 of query aligns to 7:425/456 of 7zm7B
- binding flavin mononucleotide: G59 (= G54), G61 (= G56), K70 (= K65), N91 (= N83), D93 (= D85), G182 (= G174), E183 (= E175), E184 (= E176), A218 (≠ N210), N219 (= N211), A401 (= A393), L402 (= L394)
- binding iron/sulfur cluster: P198 (= P190), C354 (= C346), G355 (= G347), Q356 (= Q348), C357 (= C349), C360 (= C352), T398 (= T390), C400 (= C392), L402 (= L394)
7o6yB Cryo-em structure of respiratory complex i under turnover (see paper)
67% identity, 97% coverage: 2:417/427 of query aligns to 5:423/457 of 7o6yB
- binding flavin mononucleotide: G57 (= G54), G59 (= G56), K68 (= K65), N89 (= N83), D91 (= D85), E92 (= E86), G180 (= G174), E181 (= E175), E182 (= E176), T216 (≠ N210), N217 (= N211)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G59 (= G56), G60 (= G57), F63 (= F60), K68 (= K65), E94 (= E88), Y177 (= Y171), E182 (= E176), F202 (= F196), T324 (= T318)
- binding iron/sulfur cluster: P196 (= P190), S351 (= S345), C352 (= C346), G353 (= G347), Q354 (= Q348), C355 (= C349), C358 (= C352), T396 (= T390), C398 (= C392), L400 (= L394)
7b0nF 3.7-angstrom structure of Yarrowia lipolytica complex I with an R121M mutation in NUCM. (see paper)
67% identity, 97% coverage: 2:417/427 of query aligns to 6:424/460 of 7b0nF
- binding flavin mononucleotide: G60 (= G56), K69 (= K65), N90 (= N83), D92 (= D85), E93 (= E86), G94 (= G87), Y178 (= Y171), G181 (= G174), E182 (= E175), N218 (= N211)
- binding iron/sulfur cluster: P197 (= P190), S352 (= S345), C353 (= C346), Q355 (= Q348), C356 (= C349), C359 (= C352), T397 (= T390), C399 (= C392)
8e9hF Mycobacterial respiratory complex i, fully-inserted quinone (see paper)
50% identity, 93% coverage: 18:412/427 of query aligns to 17:416/436 of 8e9hF
- binding flavin mononucleotide: G53 (= G54), R54 (= R55), G55 (= G56), A57 (= A58), K64 (= K65), N90 (= N83), D92 (= D85), Y178 (= Y171), G181 (= G174), E182 (= E175), E183 (= E176), N217 (= N210), N218 (= N211), S221 (= S214), L398 (= L394)
- binding iron/sulfur cluster: P197 (= P190), S349 (= S345), C350 (= C346), G351 (= G347), K352 (≠ Q348), C353 (= C349), C356 (= C352), S394 (≠ T390), F395 (≠ I391), C396 (= C392), L398 (= L394), G399 (= G395)
- binding zinc ion: C333 (≠ D329), E371 (≠ V367)
Sites not aligning to the query:
Q56222 NADH-quinone oxidoreductase subunit 1; NADH dehydrogenase I chain 1; NDH-1 subunit 1; EC 7.1.1.- from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
49% identity, 92% coverage: 17:410/427 of query aligns to 26:418/438 of Q56222
4hea1 Crystal structure of the entire respiratory complex i from thermus thermophilus (see paper)
49% identity, 92% coverage: 17:410/427 of query aligns to 25:417/437 of 4hea1
- binding flavin mononucleotide: G63 (= G54), K74 (= K65), N91 (= N83), D93 (= D85), Y179 (= Y171), G182 (= G174), E183 (= E175), N218 (= N210), N219 (= N211), L401 (= L394)
- binding iron/sulfur cluster: I180 (= I172), P198 (= P190), S351 (= S345), C352 (= C346), G353 (= G347), K354 (≠ Q348), C355 (= C349), C358 (= C352), F398 (≠ I391), C399 (= C392), L401 (= L394)
2ybb1 Fitted model for bovine mitochondrial supercomplex i1iii2iv1 by single particle cryo-em (emd-1876) (see paper)
49% identity, 92% coverage: 17:410/427 of query aligns to 25:417/437 of 2ybb1
- binding flavin mononucleotide: G63 (= G54), G65 (= G56), N91 (= N83), D93 (= D85), G182 (= G174), E183 (= E175), E184 (= E176), N218 (= N210), N219 (= N211), T222 (≠ S214), P400 (≠ A393)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G65 (= G56), G66 (= G57), F69 (= F60), K74 (= K65), F77 (= F68), E96 (= E88), Y179 (= Y171), E184 (= E176), K201 (= K193), F204 (= F196), T324 (= T318)
- binding iron/sulfur cluster: S351 (= S345), C352 (= C346), K354 (≠ Q348), C355 (= C349), C358 (= C352), F398 (≠ I391), C399 (= C392), L401 (= L394), A402 (≠ G395)
7p61F Complex i from e. Coli, ddm-purified, with nadh, resting state (see paper)
45% identity, 88% coverage: 41:417/427 of query aligns to 48:423/442 of 7p61F
- binding flavin mononucleotide: G61 (= G54), G63 (= G56), K72 (= K65), N90 (= N83), D92 (= D85), G181 (= G174), E182 (= E175), N217 (= N210), N218 (= N211), A399 (= A393), H400 (≠ L394)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G63 (= G56), G64 (= G57), A65 (= A58), F67 (= F60), K72 (= K65), L75 (≠ F68), E95 (= E88), Y178 (= Y171), E183 (= E176), F203 (= F196), R320 (≠ G315), T323 (= T318)
- binding iron/sulfur cluster: S350 (= S345), C351 (= C346), W353 (≠ Q348), C354 (= C349), C357 (= C352), F397 (≠ I391), C398 (= C392), H400 (≠ L394)
Query Sequence
>WP_011385160.1 NCBI__GCF_000009985.1:WP_011385160.1
MLRDSDRIFTNLYGIHDWRLKGAMARGDWNGTKDILAKGRDWIIEEMKNSGLRGRGGAGF
PTGVKWSFMPKTEGPRPHYLVINADEGEPGTCKDREMMRFDPHKLIEGALIASFAIGAHA
AYIYIRGEFVREAEHLNIAIDEARAAGLLGPNACGSGWDCEVYVHRGAGAYICGEESALI
ESLEGKKGQPRLKPPFPAGVGLYGCPTTVNNVESIAVAPTILRRGAAWFSGLGKPNNTGT
KVFCISGHVNTPCNVEEEMGIPLKELIEKHAGGVRGGWDNLLAIIPGGSSVPMLTKQQCE
EVTMDFDALRAMRSGLGTAAVMVMDKSTDLVRAIHRLSRFYWHESCGQCTPCREGTGWMS
RMMGRMVTGDAELSEIDLLEEISRQIEGHTICALGDAAAWPIQGLIRAFRPEMERRILDR
QAKTNAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory