Comparing WP_011385293.1 NCBI__GCF_000009985.1:WP_011385293.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
40% identity, 99% coverage: 1:222/225 of query aligns to 4:222/648 of P75831
5ws4A Crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii (see paper)
39% identity, 100% coverage: 1:225/225 of query aligns to 4:225/650 of 5ws4A
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
36% identity, 99% coverage: 1:222/225 of query aligns to 3:221/615 of 5lilA
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
36% identity, 99% coverage: 1:222/225 of query aligns to 3:221/592 of 5lj7A
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
37% identity, 97% coverage: 1:219/225 of query aligns to 3:218/226 of 5xu1B
2pclA Crystal structure of abc transporter with complex (aq_297) from aquifex aeolicus vf5
41% identity, 91% coverage: 19:222/225 of query aligns to 16:217/223 of 2pclA
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
38% identity, 98% coverage: 1:221/225 of query aligns to 1:223/232 of 1f3oA
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
38% identity, 98% coverage: 1:221/225 of query aligns to 1:223/230 of 1l2tA
8tzjA Cryo-em structure of vibrio cholerae ftse/ftsx complex (see paper)
35% identity, 99% coverage: 1:223/225 of query aligns to 2:219/220 of 8tzjA
8iddA Cryo-em structure of mycobacterium tuberculosis atp bound ftsex/ripc complex in peptidisc (see paper)
38% identity, 99% coverage: 1:222/225 of query aligns to 2:218/225 of 8iddA
A5U7B7 Cell division ATP-binding protein FtsE from Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) (see 2 papers)
38% identity, 99% coverage: 1:222/225 of query aligns to 1:217/229 of A5U7B7
8igqA Cryo-em structure of mycobacterium tuberculosis adp bound ftsex/ripc complex in peptidisc (see paper)
38% identity, 99% coverage: 1:222/225 of query aligns to 2:218/227 of 8igqA
8g4cB Bceabs atpgs high res tm (see paper)
31% identity, 98% coverage: 1:221/225 of query aligns to 3:221/248 of 8g4cB
7tchB Bceab e169q variant atp-bound conformation (see paper)
31% identity, 98% coverage: 1:221/225 of query aligns to 2:220/245 of 7tchB
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
37% identity, 99% coverage: 1:223/225 of query aligns to 1:221/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
37% identity, 99% coverage: 1:223/225 of query aligns to 2:222/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
37% identity, 99% coverage: 1:223/225 of query aligns to 2:222/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
37% identity, 99% coverage: 1:223/225 of query aligns to 2:222/344 of 6cvlD
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
38% identity, 99% coverage: 1:223/225 of query aligns to 1:216/240 of 4ymuJ
8w6iD Cryo-em structure of escherichia coli str k12 ftsex complex with atp- gamma-s in peptidisc
38% identity, 89% coverage: 1:201/225 of query aligns to 1:196/219 of 8w6iD
>WP_011385293.1 NCBI__GCF_000009985.1:WP_011385293.1
MIHLSDVRKAFNQGKSNEFWALKGIDLSVRAGKVTVFRGPSGSGKTTLLTLVGCLARPTS
GRVRLRDRDISGLPERFLTDIRRSTFGFVFQQFNLLKGISALENVMIPAYPLGVDRKELS
ERAHALMESLGIGAKASSMAEWLSGGEAQRVAIARALINDPEVVIADEPTANLDSERSRQ
FLAIVETLKASGKTVLMTSHDPLVCDTEVVDHVVSLRDGQLVEAR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory