SitesBLAST
Comparing WP_011385366.1 NCBI__GCF_000009985.1:WP_011385366.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6iunB Crystal structure of enoyl-coa hydratase (ech) from ralstonia eutropha h16 in complex with NAD
46% identity, 98% coverage: 8:694/703 of query aligns to 5:690/692 of 6iunB
- active site: A60 (= A63), F65 (= F68), E73 (≠ A74), H77 (≠ Q78), G101 (≠ A102), E104 (= E105), E124 (= E125), G132 (= G133), K248 (≠ R251), S407 (= S410), H428 (= H431), E440 (= E443), N478 (= N481)
- binding nicotinamide-adenine-dinucleotide: G300 (= G303), T301 (= T304), M302 (= M305), E321 (≠ D324), T322 (≠ V325), Y365 (= Y368), A377 (= A380), V378 (= V381), E380 (= E383), V384 (≠ L387), V388 (≠ I391), N405 (= N408), S407 (= S410)
Q08426 Peroxisomal bifunctional enzyme; PBE; PBFE; L-bifunctional protein; LBP; Multifunctional enzyme 1; MFE1; EC 4.2.1.17; EC 5.3.3.8; EC 1.1.1.35 from Homo sapiens (Human) (see 5 papers)
37% identity, 98% coverage: 9:699/703 of query aligns to 7:714/723 of Q08426
- V40 (≠ F38) to G: in dbSNP:rs1062551
- I41 (≠ T39) to R: in dbSNP:rs1062552
- T75 (≠ K73) to I: in dbSNP:rs1062553
- K165 (≠ E166) modified: N6-acetyllysine; alternate; mutation to Q: Greatly reduced acetylation and insensitive to treatment with TSA and NAM; when associated with Q-171; Q-346 and Q-584.
- K171 (≠ E172) modified: N6-acetyllysine; mutation to Q: Greatly reduced acetylation and insensitive to treatment with TSA and NAM; when associated with Q-165; Q-346 and Q-584.
- A274 (= A275) to T: in dbSNP:rs2302819
- A325 (≠ I322) to G: in dbSNP:rs1062555
- K346 (≠ R343) modified: N6-acetyllysine; mutation to Q: Greatly reduced acetylation and insensitive to treatment with TSA and NAM; when associated with Q-165; Q-171 and Q-584.
- K584 (≠ S572) modified: N6-acetyllysine; alternate; mutation to Q: Greatly reduced acetylation and insensitive to treatment with TSA and NAM; when associated with Q-165; Q-171 and Q-346.
- K598 (≠ E585) to T: in dbSNP:rs1042437
- T606 (≠ R593) to P: in dbSNP:rs1042438
Sites not aligning to the query:
- 3 E → K: in FRTS3; the mutant is mistargeted to mitochondria; results in impaired mitochondrial oxidative phosphorylation and defects in the transport of fluids across the epithelium of renal proximal tubular cells; dbSNP:rs398124646
3zwaA Crystal structure of rat peroxisomal multifunctional enzyme type 1 (rpmfe1) complexed with 3s-hydroxy-hexanoyl-coa (see paper)
37% identity, 99% coverage: 7:699/703 of query aligns to 11:719/727 of 3zwaA
- active site: A67 (= A63), F72 (= F68), G82 (≠ Q78), G106 (≠ A102), E109 (= E105), P128 (= P124), E129 (= E125), P136 (= P132), G137 (= G133), K255 (≠ R251), S416 (= S410), H437 (= H431), E449 (= E443), N487 (= N481)
- binding (S)-3-Hydroxyhexanoyl-CoA: V27 (= V23), A65 (= A61), G66 (= G62), A67 (= A63), D68 (= D64), I69 (= I65), L104 (= L100), E109 (= E105), R124 (= R120), E129 (= E125), L132 (= L128), G137 (= G133), Y162 (≠ P158)
5omoA Crystal structure of rat peroxisomal multifunctional enzyme type-1 (rpmfe1) complexed with with 3s-hydroxy-decanoyl-coa and 3-keto- decanoyl-coa
37% identity, 99% coverage: 7:699/703 of query aligns to 10:718/725 of 5omoA
- active site: A66 (= A63), F71 (= F68), G81 (≠ Q78), G105 (≠ A102), E108 (= E105), P127 (= P124), E128 (= E125), P135 (= P132), G136 (= G133), K254 (≠ R251), S415 (= S410), H436 (= H431), E448 (= E443), N486 (= N481)
- binding (s)-3-hydroxydecanoyl-coa: P25 (= P22), V26 (= V23), A28 (= A25), P31 (vs. gap), A64 (= A61), A66 (= A63), D67 (= D64), I68 (= I65), L103 (= L100), G105 (≠ A102), E108 (= E105), P127 (= P124), E128 (= E125), Y161 (≠ P158), F260 (≠ S257), K280 (≠ R277)
- binding 3-keto-decanoyl-coa: S415 (= S410), N486 (= N481), K519 (≠ A514), M520 (= M515), V525 (= V520), Y658 (= Y641)
5mgbA Crystal structure of rat peroxisomal multifunctional enzyme type-1 (rpmfe1) complexed with acetoacetyl-coa and NAD (see paper)
37% identity, 99% coverage: 7:699/703 of query aligns to 10:718/725 of 5mgbA
- active site: A66 (= A63), F71 (= F68), G81 (≠ Q78), G105 (≠ A102), E108 (= E105), P127 (= P124), E128 (= E125), P135 (= P132), G136 (= G133), K254 (≠ R251), S415 (= S410), H436 (= H431), E448 (= E443), N486 (= N481)
- binding acetoacetyl-coenzyme a: P25 (= P22), V26 (= V23), A64 (= A61), G65 (= G62), A66 (= A63), D67 (= D64), I68 (= I65), G105 (≠ A102), E128 (= E125), Y161 (≠ P158)
- binding nicotinamide-adenine-dinucleotide: L307 (≠ I300), G308 (= G301), G310 (= G303), T311 (= T304), M312 (= M305), E331 (≠ D324), S332 (≠ V325), Q336 (≠ N329), V386 (= V381), F387 (= F382), E388 (= E383), N413 (= N408), S415 (= S410), H436 (= H431)
3zwcA Crystal structure of rat peroxisomal multifunctional enzyme type 1 (rpmfe1) complexed with 3s-hydroxy-decanoyl-coa (see paper)
37% identity, 99% coverage: 7:699/703 of query aligns to 10:718/725 of 3zwcA
- active site: A66 (= A63), F71 (= F68), G81 (≠ Q78), G105 (≠ A102), E108 (= E105), P127 (= P124), E128 (= E125), P135 (= P132), G136 (= G133), K254 (≠ R251), S415 (= S410), H436 (= H431), E448 (= E443), N486 (= N481)
- binding (s)-3-hydroxydecanoyl-coa: V26 (= V23), A64 (= A61), G65 (= G62), A66 (= A63), D67 (= D64), I68 (= I65), G77 (≠ A74), L78 (≠ P75), L80 (≠ H77), V101 (≠ T98), G104 (= G101), G105 (≠ A102), E108 (= E105), E128 (= E125), F260 (≠ S257)
- binding nicotinamide-adenine-dinucleotide: G308 (= G301), G310 (= G303), T311 (= T304), M312 (= M305), E331 (≠ D324), Q336 (≠ N329), A385 (= A380), V386 (= V381), F387 (= F382), E388 (= E383), K393 (= K388), N413 (= N408), S415 (= S410), H436 (= H431)
2x58A The crystal structure of mfe1 liganded with coa (see paper)
37% identity, 99% coverage: 7:699/703 of query aligns to 10:718/725 of 2x58A
- active site: A66 (= A63), F71 (= F68), G81 (≠ Q78), G105 (≠ A102), E108 (= E105), P127 (= P124), E128 (= E125), P135 (= P132), G136 (= G133), K254 (≠ R251), S415 (= S410), H436 (= H431), E448 (= E443), N486 (= N481)
- binding adenosine-5'-diphosphate: G310 (= G303), T311 (= T304), M312 (= M305), E331 (≠ D324), S332 (≠ V325), Q336 (≠ N329), V386 (= V381), L392 (= L387)
- binding coenzyme a: V26 (= V23), A28 (= A25), A64 (= A61), A66 (= A63), D67 (= D64), I68 (= I65), E128 (= E125)
3zw9A Crystal structure of rat peroxisomal multifunctional enzyme type 1 (rpmfe1) complexed with (2s,3s)-3-hydroxy-2- methylbutanoyl-coa (see paper)
37% identity, 99% coverage: 7:699/703 of query aligns to 8:716/723 of 3zw9A
- active site: A64 (= A63), F69 (= F68), G79 (≠ Q78), G103 (≠ A102), E106 (= E105), P125 (= P124), E126 (= E125), P133 (= P132), G134 (= G133), K252 (≠ R251), S413 (= S410), H434 (= H431), E446 (= E443), N484 (= N481)
- binding nicotinamide-adenine-dinucleotide: L305 (≠ I300), G306 (= G301), G308 (= G303), T309 (= T304), M310 (= M305), E329 (≠ D324), Q334 (≠ N329), A383 (= A380), V384 (= V381), F385 (= F382), E386 (= E383), N411 (= N408), S413 (= S410), H434 (= H431)
- binding (2s,3s)-3-hydroxy-2-methylbutanoyl-coa: V24 (= V23), A62 (= A61), G63 (= G62), A64 (= A63), I66 (= I65), G102 (= G101), G103 (≠ A102), E106 (= E105), E126 (= E125), P133 (= P132), Y159 (≠ P158)
6zicAAA structure of rat peroxisomal multifunctional enzyme type-1 (rpmfe1) complexed with 3s-hydroxybutanoyl-coa and nadh'
37% identity, 99% coverage: 7:699/703 of query aligns to 10:716/723 of 6zicAAA
- active site: A66 (= A63), F71 (= F68), G81 (≠ Q78), G105 (≠ A102), E108 (= E105), P127 (= P124), E128 (= E125), G136 (= G133), K254 (≠ R251), S413 (= S410), H434 (= H431), E446 (= E443), N484 (= N481)
- binding 3-hydroxybutanoyl-coenzyme a: P25 (= P22), V26 (= V23), A28 (= A25), A66 (= A63), D67 (= D64), I68 (= I65), G104 (= G101), G105 (≠ A102), E108 (= E105), E128 (= E125), Y161 (≠ P158)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G308 (= G301), G310 (= G303), T311 (= T304), M312 (= M305), E331 (≠ D324), S332 (≠ V325), Q336 (≠ N329), A383 (= A380), V384 (= V381), F385 (= F382), E386 (= E383), L390 (= L387), K391 (= K388), N411 (= N408), S413 (= S410), H434 (= H431)
6zibAAA structure of rat peroxisomal multifunctional enzyme type-1 (rpmfe1) complexed with acetoacetyl-coa and nadh'
37% identity, 99% coverage: 7:699/703 of query aligns to 10:716/723 of 6zibAAA
- active site: A66 (= A63), F71 (= F68), G81 (≠ Q78), G105 (≠ A102), E108 (= E105), P127 (= P124), E128 (= E125), G136 (= G133), K254 (≠ R251), S413 (= S410), H434 (= H431), E446 (= E443), N484 (= N481)
- binding acetoacetyl-coenzyme a: P25 (= P22), V26 (= V23), A64 (= A61), G65 (= G62), A66 (= A63), D67 (= D64), I68 (= I65), G104 (= G101), G105 (≠ A102), E128 (= E125), Y161 (≠ P158)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G310 (= G303), T311 (= T304), M312 (= M305), E331 (≠ D324), S332 (≠ V325), Q336 (≠ N329), A383 (= A380), V384 (= V381), F385 (= F382), E386 (= E383), N411 (= N408), H434 (= H431)
6z5oAAA Peroxisomal bifunctional enzyme (see paper)
37% identity, 99% coverage: 7:699/703 of query aligns to 11:712/716 of 6z5oAAA
- active site: A67 (= A63), F72 (= F68), G82 (≠ Q78), G106 (≠ A102), E109 (= E105), P128 (= P124), E129 (= E125), G137 (= G133), K255 (≠ R251), S409 (= S410), H430 (= H431), E442 (= E443), N480 (= N481)
- binding coenzyme a: P26 (= P22), V27 (= V23), A65 (= A61), D68 (= D64), I69 (= I65), P128 (= P124), Y162 (≠ P158), F277 (= F273), K281 (≠ R277)
- binding nicotinamide-adenine-dinucleotide: G309 (= G301), G311 (= G303), T312 (= T304), M313 (= M305), E332 (≠ D324), S333 (≠ V325), Q337 (≠ N329), A379 (= A380), V380 (= V381), F381 (= F382), E382 (= E383), K387 (= K388), N407 (= N408), S409 (= S410), H430 (= H431)
- binding nicotinamide: A67 (= A63), E109 (= E105), E129 (= E125), P136 (= P132), F261 (≠ S257)
3zwbA Crystal structure of rat peroxisomal multifunctional enzyme type 1 (rpmfe1) complexed with 2trans-hexenoyl-coa (see paper)
37% identity, 99% coverage: 7:699/703 of query aligns to 10:718/725 of 3zwbA
- active site: A66 (= A63), G81 (≠ Q78), G105 (≠ A102), E108 (= E105), P127 (= P124), A128 (≠ E125), P135 (= P132), G136 (= G133), S415 (= S410), H436 (= H431), E448 (= E443), N486 (= N481)
- binding (2E)-Hexenoyl-CoA: P25 (= P22), V26 (= V23), A28 (= A25), A64 (= A61), G65 (= G62), A66 (= A63), D67 (= D64), I68 (= I65), V101 (≠ T98), L103 (= L100), G105 (≠ A102), E108 (= E105), G136 (= G133), Y161 (≠ P158), K280 (≠ R277)
6yswA E. Coli anaerobic trifunctional enzyme subunit-alpha in complex with coenzyme a
33% identity, 99% coverage: 2:700/703 of query aligns to 1:706/707 of 6yswA
- active site: A66 (= A63), I71 (vs. gap), A84 (vs. gap), Q88 (= Q78), G112 (≠ A102), E115 (= E105), P136 (= P124), E137 (= E125), G145 (= G133), D264 (≠ R251), S422 (= S410), H443 (= H431), E455 (= E443), N493 (= N481)
- binding coenzyme a: E23 (vs. gap), M25 (≠ V23), A66 (= A63), D67 (= D64), I68 (= I65), P136 (= P124), E137 (= E125), L140 (= L128), T290 (≠ R277), K293 (≠ R280)
6tnmA E. Coli aerobic trifunctional enzyme subunit-alpha (see paper)
32% identity, 96% coverage: 9:686/703 of query aligns to 13:706/719 of 6tnmA
- active site: A68 (= A63), F73 (= F68), G116 (≠ A102), E119 (= E105), P138 (= P124), E139 (= E125), G147 (= G133), N271 (≠ R251), S429 (= S410), H450 (= H431), E462 (= E443), N500 (= N481)
- binding adenosine-5'-triphosphate: D343 (= D324), I344 (≠ V325), V400 (= V381), V401 (≠ F382), V406 (≠ L387), K584 (= K562)
P21177 Fatty acid oxidation complex subunit alpha; EC 4.2.1.17; EC 5.1.2.3; EC 5.3.3.8; EC 1.1.1.35 from Escherichia coli (strain K12) (see 2 papers)
32% identity, 96% coverage: 9:686/703 of query aligns to 13:706/729 of P21177
- G116 (≠ A102) mutation to F: Absence of both enoyl-CoA hydratase and 3-hydroxyacyl-CoA epimerase activities. Delta(3)-cis-Delta(2)-trans-enoyl-CoA isomerase is only slightly affected.
- G322 (= G303) mutation to A: 10-fold increase in KM for NADH.
- H450 (= H431) active site, For 3-hydroxyacyl-CoA dehydrogenase activity; mutation H->A,Q: Almost complete loss of 3-hydroxyacyl-CoA dehydrogenase activity.
P40939 Trifunctional enzyme subunit alpha, mitochondrial; 78 kDa gastrin-binding protein; Monolysocardiolipin acyltransferase; TP-alpha; EC 2.3.1.-; EC 4.2.1.17; EC 1.1.1.211 from Homo sapiens (Human) (see 5 papers)
29% identity, 97% coverage: 5:684/703 of query aligns to 41:750/763 of P40939
- V282 (= V221) to D: in MTPD1; mild phenotype with slowly progressive myopathy and sensorimotor polyneuropathy; dbSNP:rs137852773
- I305 (≠ L235) to N: in MTPD1; mild phenotype with slowly progressive myopathy and sensorimotor polyneuropathy; dbSNP:rs137852774
- L342 (= L272) to P: in LCHAD deficiency; dbSNP:rs137852772
- E510 (= E443) active site, For hydroxyacyl-coenzyme A dehydrogenase activity; to Q: in AFLP and LCHAD deficiency; loss of long-chain-3-hydroxyacyl-CoA dehydrogenase activity; dbSNP:rs137852769
1wdlA Fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form ii (native4) (see paper)
30% identity, 96% coverage: 23:694/703 of query aligns to 29:713/715 of 1wdlA
- active site: A69 (= A63), N89 (vs. gap), N93 (vs. gap), G117 (≠ A102), E120 (= E105), P139 (= P124), E140 (= E125), P147 (= P132), G148 (= G133), S430 (= S410), H451 (= H431), E463 (= E443), N501 (= N481)
- binding nicotinamide-adenine-dinucleotide: A322 (= A302), I324 (≠ T304), M325 (= M305), D344 (= D324), I345 (≠ V325), A400 (= A380), V401 (= V381), E403 (= E383), N428 (= N408), T429 (= T409), S430 (= S410)
P28793 Fatty acid oxidation complex subunit alpha; EC 4.2.1.17; EC 5.1.2.3; EC 5.3.3.8; EC 1.1.1.35 from Pseudomonas fragi (see paper)
30% identity, 96% coverage: 23:694/703 of query aligns to 29:713/715 of P28793
1wdmA Fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form i (native3) (see paper)
30% identity, 96% coverage: 23:694/703 of query aligns to 29:705/707 of 1wdmA
- active site: A69 (= A63), N89 (vs. gap), N93 (vs. gap), G117 (≠ A102), E120 (= E105), P139 (= P124), E140 (= E125), P147 (= P132), G148 (= G133), S430 (= S410), H451 (= H431), E463 (= E443), N501 (= N481)
- binding acetyl coenzyme *a: K142 (≠ S127), D297 (= D276), M459 (= M439), N501 (= N481), P534 (≠ A514), Y652 (≠ A639), L658 (≠ R645)
- binding nicotinamide-adenine-dinucleotide: G321 (= G301), A322 (= A302), I324 (≠ T304), M325 (= M305), D344 (= D324), V401 (= V381), E403 (= E383), N428 (= N408), S430 (= S410), N454 (≠ S434)
7o4uA Structure of the alpha subunit of mycobacterium tuberculosis beta- oxidation trifunctional enzyme in complex with oxidized nicotinamide adenine dinucleotide (see paper)
33% identity, 91% coverage: 10:649/703 of query aligns to 10:669/711 of 7o4uA
Query Sequence
>WP_011385366.1 NCBI__GCF_000009985.1:WP_011385366.1
MSDVVTLSVSDRIATVTIDSPPVNAADHPVRAGLQKVFTDLAARSDYDAVLVLCAGRTFM
AGADIGEFDTGIKAPHHQDLFNLVENCAKPVVAALHGTALGAGTELAMACHYRIADKGAR
IGLPELSLGIIPGAGGTQRAPRLIGLDAAMDLVLSGKPLPAPKAAELGLVDEIASGDLNA
AALAFAKKLVAEGKGVRRTCDMAPKDAAKDAEIIAARQAQVAKTMKNRTSPLKALEAMAA
TTTLSFAEGLRLEADISKQLEHAVEARAMRHLFFADREVRKIPGITKDIKARPIRKVGII
GAGTMGGGIAMCFANIGIPVTIIDVSDENLQRGLGVIRKNYERSVSRGSLTQEQLESRMG
LLSASTDYAALKDADLAIEAVFEKMELKKDIFAKLDAVLPAGAILGTNTSTLDIDEIANT
TKRPADVIGLHFFSPANVMPLLEIVQGKQTAMDVLLTALDMAKLIKKTGVVSKVCYGFIG
NRMMDPYGREAERMVLEGATPAEIDGALEGWGMAMGILAVYDMAGVEVGDNTRIANPHMV
PDDPSFYRCSTLLVANKWLGQKVGRGYYRYDSPDRKRASDPEVIEMMHAEGKRLNVPARK
PGKDEILERCLYSMINEGAKLLEEGIALRASDIDVVYTAGYGFPRYRGGPMFYADTIGLK
VIYDKIVEFQKTLDPRYWTPAPLLEKLAKAGSTFAQWDASKAK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory