Comparing WP_011385407.1 NCBI__GCF_000009985.1:WP_011385407.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1t3dA Crystal structure of serine acetyltransferase from e.Coli at 2.2a (see paper)
48% identity, 61% coverage: 9:169/263 of query aligns to 84:244/262 of 1t3dA
8i04A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with serine (see paper)
48% identity, 61% coverage: 9:169/263 of query aligns to 80:240/258 of 8i04A
8i09A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with butyl gallate (see paper)
48% identity, 61% coverage: 9:169/263 of query aligns to 83:243/246 of 8i09A
8i06A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with coa (see paper)
48% identity, 61% coverage: 9:169/263 of query aligns to 84:244/244 of 8i06A
1ssqD Serine acetyltransferase- complex with cysteine (see paper)
45% identity, 63% coverage: 9:175/263 of query aligns to 80:246/257 of 1ssqD
6wyeA Crystal structure of neisseria gonorrhoeae serine acetyltransferase (cyse) (see paper)
44% identity, 65% coverage: 2:171/263 of query aligns to 78:247/261 of 6wyeA
4h7oA Crystal structure of serine acetyltransferase from vibrio cholerae o1 biovar el tor n16961
46% identity, 63% coverage: 9:173/263 of query aligns to 80:244/258 of 4h7oA
Sites not aligning to the query:
3gvdI Crystal structure of serine acetyltransferase cyse from yersinia pestis
45% identity, 63% coverage: 5:169/263 of query aligns to 83:247/272 of 3gvdI
7ra4A Crystal structure of neisseria gonorrhoeae serine acetyltransferase (cyse) in complex with serine (see paper)
44% identity, 64% coverage: 2:169/263 of query aligns to 76:243/243 of 7ra4A
4hzdA Crystal structure of serine acetyltransferase in complex with coenzyme a from brucella abortus strain s19 (see paper)
43% identity, 62% coverage: 6:169/263 of query aligns to 81:244/250 of 4hzdA
4n69A Soybean serine acetyltransferase complexed with serine (see paper)
48% identity, 61% coverage: 9:169/263 of query aligns to 83:243/243 of 4n69A
1sstA Serine acetyltransferase- complex with coa (see paper)
45% identity, 61% coverage: 9:169/263 of query aligns to 80:233/233 of 1sstA
4n6bA Soybean serine acetyltransferase complexed with coa (see paper)
47% identity, 61% coverage: 9:169/263 of query aligns to 79:233/233 of 4n6bA
7bw9A Crystal structure of serine acetyltransferase isoform 3 in complex with cysteine from entamoeba histolytica
43% identity, 57% coverage: 6:155/263 of query aligns to 103:252/280 of 7bw9A
3p47A Crystal structure of entamoeba histolytica serine acetyltransferase 1 in complex with l-cysteine (see paper)
40% identity, 61% coverage: 2:161/263 of query aligns to 101:268/270 of 3p47A
3q1xA Crystal structure of entamoeba histolytica serine acetyltransferase 1 in complex with l-serine (see paper)
40% identity, 61% coverage: 2:161/263 of query aligns to 99:266/267 of 3q1xA
G3XD01 UDP-2-acetamido-3-amino-2,3-dideoxy-D-glucuronate N-acetyltransferase; UDP-D-GlcNAc3NA N-acetyltransferase; UDP-2-acetamido-3-amino-2,3-dideoxy-alpha-D-glucuronic acid 3-N-acetyltransferase; EC 2.3.1.201 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
29% identity, 43% coverage: 57:169/263 of query aligns to 23:152/191 of G3XD01
P07464 Galactoside O-acetyltransferase; GAT; Acetyl-CoA:galactoside 6-O-acetyltransferase; Thiogalactoside acetyltransferase; Thiogalactoside transacetylase; EC 2.3.1.18 from Escherichia coli (strain K12) (see 3 papers)
29% identity, 41% coverage: 74:180/263 of query aligns to 77:193/203 of P07464
Sites not aligning to the query:
1krrA Galactoside acetyltransferase in complex with acetyl-coenzyme a (see paper)
29% identity, 41% coverage: 74:180/263 of query aligns to 76:192/200 of 1krrA
1krvA Galactoside acetyltransferase in complex with coa and pnp-beta-gal (see paper)
29% identity, 41% coverage: 74:180/263 of query aligns to 76:192/201 of 1krvA
Sites not aligning to the query:
>WP_011385407.1 NCBI__GCF_000009985.1:WP_011385407.1
MIFKSLQEDIASIRKRDPAAHSWLEVLLCYPGLHALMFHRLSNWCWNRGLRVLGRFVSHV
GKILTGIEIHPAAQLGPRFFIDHGTGVVIGETAVIGADVTIYHGVTLGGTSLHKGKRHPT
LEDGVIVGSGAQVLGPITVGKGARIGANAVVLTDVPPGVTMVGIPARMVMRRQDADFCAY
GLPVEDLPDPVVRAIDSVRSQVATLMERIKELETELHGHPTQACARLSQPEGAEPGDKTK
QVEAVTMPAGGTTGRTLERETIS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory