Comparing WP_011385558.1 NCBI__GCF_000009985.1:WP_011385558.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O43175 D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; Malate dehydrogenase; EC 1.1.1.95; EC 1.1.1.399; EC 1.1.1.37 from Homo sapiens (Human) (see 3 papers)
44% identity, 76% coverage: 3:402/526 of query aligns to 8:409/533 of O43175
Sites not aligning to the query:
3dc2A Crystal structure of serine bound d-3-phosphoglycerate dehydrogenase from mycobacterium tuberculosis (see paper)
40% identity, 96% coverage: 1:507/526 of query aligns to 1:507/526 of 3dc2A
3ddnB Crystal structure of hydroxypyruvic acid phosphate bound d-3- phosphoglycerate dehydrogenase in mycobacterium tuberculosis (see paper)
40% identity, 96% coverage: 1:507/526 of query aligns to 2:506/525 of 3ddnB
7dkmA Phgdh covalently linked to oridonin (see paper)
51% identity, 57% coverage: 3:302/526 of query aligns to 4:303/306 of 7dkmA
6plgA Crystal structure of human phgdh complexed with compound 15 (see paper)
51% identity, 57% coverage: 3:302/526 of query aligns to 3:302/303 of 6plgA
6plfA Crystal structure of human phgdh complexed with compound 1 (see paper)
51% identity, 57% coverage: 3:302/526 of query aligns to 4:303/305 of 6plfA
7ewhA Crystal structure of human phgdh in complex with homoharringtonine (see paper)
51% identity, 57% coverage: 3:302/526 of query aligns to 3:302/302 of 7ewhA
6rihA Crystal structure of phgdh in complex with compound 9 (see paper)
51% identity, 57% coverage: 3:302/526 of query aligns to 3:302/302 of 6rihA
6rj5A Crystal structure of phgdh in complex with compound 39 (see paper)
51% identity, 57% coverage: 3:300/526 of query aligns to 3:300/301 of 6rj5A
6cwaA Crystal structure phgdh in complex with nadh and 3-phosphoglycerate at 1.77 a resolution (see paper)
51% identity, 57% coverage: 3:300/526 of query aligns to 2:299/299 of 6cwaA
6rj2A Crystal structure of phgdh in complex with compound 40 (see paper)
51% identity, 57% coverage: 4:302/526 of query aligns to 1:299/299 of 6rj2A
6rj3A Crystal structure of phgdh in complex with compound 15 (see paper)
51% identity, 56% coverage: 3:298/526 of query aligns to 2:297/297 of 6rj3A
6plfB Crystal structure of human phgdh complexed with compound 1 (see paper)
49% identity, 57% coverage: 3:300/526 of query aligns to 2:291/292 of 6plfB
7cvpA The crystal structure of human phgdh from biortus.
44% identity, 57% coverage: 3:300/526 of query aligns to 2:254/254 of 7cvpA
1wwkA Crystal structure of phosphoglycerate dehydrogenase from pyrococcus horikoshii ot3
42% identity, 57% coverage: 3:302/526 of query aligns to 2:302/304 of 1wwkA
5ofwA Crystal structure of human 3-phosphoglycerate dehydrogenase in complex with 3-chloro-4-fluorobenzamide (see paper)
52% identity, 37% coverage: 96:287/526 of query aligns to 2:193/195 of 5ofwA
5ofvA Crystal structure of human 3-phosphoglycerate dehydrogenase in complex with 5-fluoro-2-methylbenzoic acid (see paper)
52% identity, 37% coverage: 96:287/526 of query aligns to 2:193/195 of 5ofvA
5ofmA Crystal structure of human 3-phosphoglycerate dehydrogenase in complex with 5-amino-1-methyl-1h-indole
52% identity, 37% coverage: 96:287/526 of query aligns to 2:193/195 of 5ofmA
5nzqA Crystal structure of human 3-phosphoglycerate dehydrogenase in complex with 3-(1,3-oxazol-5-yl)aniline. (see paper)
52% identity, 37% coverage: 96:287/526 of query aligns to 2:193/195 of 5nzqA
5nzpA Crystal structure of human 3-phosphoglycerate dehydrogenase in complex with 3-hydroxybenzisoxazole (see paper)
52% identity, 37% coverage: 96:287/526 of query aligns to 2:193/195 of 5nzpA
>WP_011385558.1 NCBI__GCF_000009985.1:WP_011385558.1
MPKVLISDKLSPAAVQIFKDRGIETDVKTGLAPDELKAIIGQYDGLAIRSNTKVTTEILA
AATNLKVVGRAGIGVDNVDVPAATARGIVVMNTPFGNSITTAEHAIAMMFALAREIPEAN
ASTHAGKWEKNRFMGVELTGKVLGIVGCGNIGAIVADRAQGLRMRVIAYDPFLSVERAKE
LNVEKVELDELFPRADFITLHTPLTDATRNIIDAKAMAKMKKGVRIINCARGGLVVEEDL
LAALESGQVAGAALDVFKTEPAKENALFGNPKVVCTPHLGASTSEAQENVALQVAEQMAD
YLLTGAVTNALNIPSVSAEDAPKLRPYMTLANQIGSFAGQLTETGIKDVKIEYLGHVASL
NTKPLTAMVLEGLLKPMNEAVNMVNAPVVAKERNIKVSEVKSESEGDYHTLVRLTVTTDK
RERSVAGTLFGGNKARVVEIKGISIEAELGQNMLYVTNQDKPGFIGALGSLLGANGVNIA
TFHLGRSEAGGDAILLTQVDQPVSNDLLEKVRALPQVVQAKFLTFA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory