Comparing WP_011385748.1 NCBI__GCF_000009985.1:WP_011385748.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 17 hits to proteins with known functional sites (download)
4f4fA X-ray crystal structure of plp bound threonine synthase from brucella melitensis
55% identity, 99% coverage: 1:463/467 of query aligns to 2:463/464 of 4f4fA
Q42598 Threonine synthase; TS; EC 4.2.3.1 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
40% identity, 100% coverage: 1:467/467 of query aligns to 5:514/514 of Q42598
1kl7A Crystal structure of threonine synthase from yeast (see paper)
42% identity, 90% coverage: 3:423/467 of query aligns to 7:459/509 of 1kl7A
8g1yA Crystal structure of the threonine synthase from streptococcus pneumoniae in complex with pyridoxal 5-phosphate.
38% identity, 92% coverage: 3:430/467 of query aligns to 7:446/496 of 8g1yA
1vb3A Crystal structure of threonine synthase from escherichia coli
34% identity, 93% coverage: 1:436/467 of query aligns to 1:402/428 of 1vb3A
2c2gA Crystal structure of threonine synthase from arabidopsis thaliana in complex with its cofactor pyridoxal phosphate (see paper)
28% identity, 37% coverage: 94:264/467 of query aligns to 127:287/448 of 2c2gA
2c2bA Crystallographic structure of arabidopsis thaliana threonine synthase complexed with pyridoxal phosphate and s-adenosylmethionine (see paper)
29% identity, 37% coverage: 94:264/467 of query aligns to 109:269/444 of 2c2bA
Sites not aligning to the query:
Q9S7B5 Threonine synthase 1, chloroplastic; Protein METHIONINE OVER-ACCUMULATOR 2; EC 4.2.3.1 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
28% identity, 37% coverage: 94:264/467 of query aligns to 184:344/526 of Q9S7B5
Sites not aligning to the query:
A0R220 Threonine synthase; TS; EC 4.2.3.1 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
27% identity, 68% coverage: 107:422/467 of query aligns to 64:338/360 of A0R220
2d1fA Structure of mycobacterium tuberculosis threonine synthase (see paper)
27% identity, 68% coverage: 107:422/467 of query aligns to 55:329/349 of 2d1fA
P9WG59 Threonine synthase; TS; EC 4.2.3.1 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
27% identity, 68% coverage: 107:422/467 of query aligns to 64:338/360 of P9WG59
6cgqB Threonine synthase from bacillus subtilis atcc 6633 with plp and plp- ala (see paper)
29% identity, 37% coverage: 92:262/467 of query aligns to 38:191/345 of 6cgqB
Sites not aligning to the query:
6nmxA Threonine synthase from bacillus subtilis atcc 6633 with plp and appa (see paper)
29% identity, 37% coverage: 92:262/467 of query aligns to 40:193/350 of 6nmxA
Sites not aligning to the query:
1uimA Crystal structure of threonine synthase from thermus thermophilus hb8, orthorhombic crystal form (see paper)
29% identity, 34% coverage: 107:266/467 of query aligns to 56:201/350 of 1uimA
Sites not aligning to the query:
3aexA Catalytic intermediate analogue of threonine synthase from thermus thermophilus hb8 (see paper)
29% identity, 34% coverage: 107:266/467 of query aligns to 56:201/351 of 3aexA
Sites not aligning to the query:
1v7cA Crystal structure of threonine synthase from thermus thermophilus hb8 in complex with a substrate analogue (see paper)
29% identity, 34% coverage: 107:266/467 of query aligns to 56:201/351 of 1v7cA
Sites not aligning to the query:
3aeyA Apo form of threonine synthase from thermus thermophilus hb8 (see paper)
29% identity, 34% coverage: 107:266/467 of query aligns to 55:200/350 of 3aeyA
Sites not aligning to the query:
>WP_011385748.1 NCBI__GCF_000009985.1:WP_011385748.1
MKYVSTRGAAPALDFDDVLLAGLARDGGLYLPESWPVFSAADIRAMRGLSYAELAVRVMR
PFVEGCLTEAELTRLCAESYGAFAHPAVAPLKQLGHNQWVMELFHGPTLAFKDYALQLVG
RLFDHVLKKKGQKVTIVGATSGDTGSAAIEACRDRAAVDIVILHPHGRVSEVQRRQMTTV
LSSNVRNVAVDGTFDDCQDLVKALFNDAAFRDEMNLSAVNSINWARVMAQIVYYFAAGVA
LGAPDVPMSFSVPTGNFGNVFAGYAAKLMGLPVEKLIIGSNTNDILTRFFEGGVMKADGV
VPTLSPSMDIQVSSNFERLMFLALGGDGAAVAKLMDDFRKNGAMVMPQGAWTAMREVFEG
YRFDDEATLAAMRSLKRSTGETLDPHSVIGVAAALKGHAARDCSMVALATAHPAKFPDAV
EKATGIRPGLPPHMADLFERTERLDRMGNDADLLKQYVRAFARRENA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory