Comparing WP_011385946.1 NCBI__GCF_000009985.1:WP_011385946.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
33% identity, 94% coverage: 8:257/265 of query aligns to 2:235/240 of 6mjpA
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
33% identity, 94% coverage: 8:257/265 of query aligns to 4:253/254 of 1g6hA
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
32% identity, 94% coverage: 8:257/265 of query aligns to 4:253/253 of 1g9xB
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
33% identity, 95% coverage: 8:259/265 of query aligns to 2:237/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
33% identity, 95% coverage: 8:259/265 of query aligns to 2:237/238 of 6s8gA
6mbnA Lptb e163q in complex with atp (see paper)
33% identity, 96% coverage: 6:259/265 of query aligns to 1:238/241 of 6mbnA
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
33% identity, 94% coverage: 8:257/265 of query aligns to 2:235/235 of 6mhzA
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
33% identity, 94% coverage: 8:256/265 of query aligns to 2:234/234 of 6b89A
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
33% identity, 94% coverage: 8:256/265 of query aligns to 2:234/234 of 4p31A
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
33% identity, 94% coverage: 8:255/265 of query aligns to 2:233/233 of 6b8bA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
30% identity, 91% coverage: 11:252/265 of query aligns to 4:233/240 of 4ymuJ
3d31A Modbc from methanosarcina acetivorans (see paper)
33% identity, 85% coverage: 23:246/265 of query aligns to 15:216/348 of 3d31A
Sites not aligning to the query:
1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
27% identity, 95% coverage: 8:258/265 of query aligns to 6:239/240 of 1ji0A
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
30% identity, 90% coverage: 9:247/265 of query aligns to 4:223/369 of P19566
Sites not aligning to the query:
4yerA Crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution
29% identity, 90% coverage: 8:245/265 of query aligns to 4:223/285 of 4yerA
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
29% identity, 90% coverage: 9:247/265 of query aligns to 3:222/374 of 2awnB
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
29% identity, 90% coverage: 9:247/265 of query aligns to 3:222/371 of 3puyA
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
29% identity, 90% coverage: 9:247/265 of query aligns to 3:222/371 of 3puxA
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
29% identity, 90% coverage: 9:247/265 of query aligns to 3:222/371 of 3puwA
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
29% identity, 90% coverage: 9:247/265 of query aligns to 3:222/371 of 3puvA
>WP_011385946.1 NCBI__GCF_000009985.1:WP_011385946.1
MSVTDNPVLEVRDVSLAFGGVRALTEVSFQVNKGELFSIIGPNGAGKTSMLNCVSGRYKP
TSGRVFMDGRDVTGLSPNVRATLGLGRTFQNLALFGHMSVLDNIMVGRHHLLGNNAATGA
LYWLSGARKEELAHRRKVEDIIDFLEIAHIRKAVAGTLPYGLRKRVELARAMAVEPKVIL
LDEPMAGMNLEEKEDMARYIVDLNEEWGMTVIMIEHDMGVVMDISHRVMVLEFGRKIAEG
LPDEVMNNERVKVAYLGIDEDEDVA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory