Comparing WP_011386064.1 NCBI__GCF_000009985.1:WP_011386064.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O14732 Inositol monophosphatase 2; IMP 2; IMPase 2; Inositol-1(or 4)-monophosphatase 2; Myo-inositol monophosphatase A2; EC 3.1.3.25 from Homo sapiens (Human) (see 2 papers)
31% identity, 87% coverage: 16:239/258 of query aligns to 25:254/288 of O14732
6giuA Human impase with l-690330 (see paper)
30% identity, 86% coverage: 17:238/258 of query aligns to 13:240/275 of 6giuA
6zk0AAA human impase with ebselen (see paper)
30% identity, 86% coverage: 17:238/258 of query aligns to 12:239/274 of 6zk0AAA
4as4A Structure of human inositol monophosphatase 1 (see paper)
30% identity, 86% coverage: 17:238/258 of query aligns to 13:240/274 of 4as4A
P29218 Inositol monophosphatase 1; IMP 1; IMPase 1; D-galactose 1-phosphate phosphatase; Inositol-1(or 4)-monophosphatase 1; Lithium-sensitive myo-inositol monophosphatase A1; EC 3.1.3.25; EC 3.1.3.94 from Homo sapiens (Human) (see 5 papers)
30% identity, 86% coverage: 17:238/258 of query aligns to 15:242/277 of P29218
2hhmA Structure of inositol monophosphatase, the putative target of lithium therapy (see paper)
30% identity, 86% coverage: 17:238/258 of query aligns to 11:238/272 of 2hhmA
1imbA Structural analysis of inositol monophosphatase complexes with substrates (see paper)
30% identity, 86% coverage: 17:238/258 of query aligns to 11:238/272 of 1imbA
1awbA Human myo-inositol monophosphatase in complex with d-inositol-1- phosphate and calcium
30% identity, 86% coverage: 17:238/258 of query aligns to 11:238/272 of 1awbA
1imdA Structural studies of metal binding by inositol monophosphatase: evidence for two-metal ion catalysis (see paper)
30% identity, 86% coverage: 17:238/258 of query aligns to 11:238/266 of 1imdA
O55023 Inositol monophosphatase 1; IMP 1; IMPase 1; D-galactose 1-phosphate phosphatase; Inositol-1(or 4)-monophosphatase 1; Lithium-sensitive myo-inositol monophosphatase A1; EC 3.1.3.25; EC 3.1.3.94 from Mus musculus (Mouse) (see paper)
29% identity, 86% coverage: 17:238/258 of query aligns to 15:242/277 of O55023
4as5A Structure of mouse inositol monophosphatase 1 (see paper)
29% identity, 86% coverage: 17:238/258 of query aligns to 13:240/274 of 4as5A
P20456 Inositol monophosphatase 1; IMP 1; IMPase 1; D-galactose 1-phosphate phosphatase; Inositol-1(or 4)-monophosphatase 1; Lithium-sensitive myo-inositol monophosphatase A1; EC 3.1.3.25; EC 3.1.3.94 from Bos taurus (Bovine) (see paper)
29% identity, 86% coverage: 17:238/258 of query aligns to 15:242/277 of P20456
2bjiA High resolution structure of myo-inositol monophosphatase, the target of lithium therapy (see paper)
29% identity, 86% coverage: 17:238/258 of query aligns to 13:240/274 of 2bjiA
Q9M8S8 Inositol-phosphate phosphatase; L-galactose 1-phosphate phosphatase; Myo-inositol monophosphatase; EC 3.1.3.25; EC 3.1.3.93 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
30% identity, 81% coverage: 22:231/258 of query aligns to 22:236/271 of Q9M8S8
Q19420 Inositol monophosphatase ttx-7; IMP; IMPase; Abnormal thermotaxis protein 7; D-galactose 1-phosphate phosphatase; Inositol-1(or 4)-monophosphatase; EC 3.1.3.25; EC 3.1.3.94 from Caenorhabditis elegans (see paper)
30% identity, 87% coverage: 16:239/258 of query aligns to 19:253/285 of Q19420
P95189 Histidinol-phosphatase; HolPase; Histidinol-phosphate phosphatase; EC 3.1.3.15 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
33% identity, 87% coverage: 32:255/258 of query aligns to 28:256/260 of P95189
5yhtA Crystal structure of a phosphatase from mycobacterium tuberculosis in complex with its substrate (see paper)
33% identity, 87% coverage: 32:255/258 of query aligns to 25:253/255 of 5yhtA
5zonA Histidinol phosphate phosphatase from mycobacterium tuberculosis (see paper)
33% identity, 87% coverage: 32:255/258 of query aligns to 26:254/256 of 5zonA
2cziA Crystal structure of human myo-inositol monophosphatase 2 (impa2) with calcium and phosphate ions (see paper)
30% identity, 87% coverage: 16:239/258 of query aligns to 11:231/259 of 2cziA
Q6NPM8 Bifunctional phosphatase IMPL2, chloroplastic; Histidinol-phosphatase; Histidinol-phosphate phosphatase; HPP; Inositol-phosphate phosphatase; L-galactose 1-phosphate phosphatase; Protein HISTIDINE BIOSYNTHESIS 7; Protein MYO-INOSITOL MONOPHOSPHATASE-LIKE 2; EC 3.1.3.15; EC 3.1.3.25; EC 3.1.3.93 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
29% identity, 85% coverage: 17:236/258 of query aligns to 93:309/346 of Q6NPM8
>WP_011386064.1 NCBI__GCF_000009985.1:WP_011386064.1
MTLPADLAPLLRPLEDLARRAGAVVMEVYNSDFAVRDKTDSSPVTEADERAEAIILPGLA
ALTPGVPVVAEESVAAGTIPAIGSGPFWLVDPVDGTKEFIKRNGEFTVNIGLIRDGVPVL
GVVLAPARGELWSGTGATAFKEDANGRRPIACRPLPASGAVIMTSRSHREPESLDKWMAQ
FPGATLGFAGSSLKFCLVAEGAADLYPRFGPTSEWDIAAASAVLMAAGGSVTTFDGLPMA
YGKTPKFLNPDFIARGRG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory