Comparing WP_011386136.1 NCBI__GCF_000009985.1:WP_011386136.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2vhaA Debp (see paper)
42% identity, 89% coverage: 23:292/302 of query aligns to 4:273/276 of 2vhaA
2ia4B Crystal structure of novel amino acid binding protein from shigella flexneri
42% identity, 89% coverage: 23:292/302 of query aligns to 5:274/278 of 2ia4B
8ovoA X-ray structure of the sf-iglusnfr-s72a in complex with l-aspartate
41% identity, 81% coverage: 23:268/302 of query aligns to 2:247/503 of 8ovoA
5eyfB Crystal structure of solute-binding protein from enterococcus faecium with bound glutamate
30% identity, 80% coverage: 24:264/302 of query aligns to 3:234/243 of 5eyfB
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
28% identity, 76% coverage: 34:264/302 of query aligns to 4:225/226 of 4zv1A
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
28% identity, 76% coverage: 34:264/302 of query aligns to 4:223/225 of 4zv2A
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
28% identity, 79% coverage: 26:265/302 of query aligns to 2:229/229 of 5t0wA
4z9nB Abc transporter / periplasmic binding protein from brucella ovis with glutathione bound
25% identity, 77% coverage: 26:257/302 of query aligns to 7:238/324 of 4z9nB
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
24% identity, 79% coverage: 27:264/302 of query aligns to 3:227/229 of 6svfA
8eyzA Engineered glutamine binding protein bound to gln and a cobaloxime ligand (see paper)
24% identity, 76% coverage: 36:264/302 of query aligns to 5:221/226 of 8eyzA
2v25A Structure of the campylobacter jejuni antigen peb1a, an aspartate and glutamate receptor with bound aspartate (see paper)
24% identity, 78% coverage: 27:263/302 of query aligns to 3:229/231 of 2v25A
4ymxA Crystal structure of the substrate binding protein of an amino acid abc transporter (see paper)
27% identity, 77% coverage: 34:265/302 of query aligns to 1:223/224 of 4ymxA
1xt8B Crystal structure of cysteine-binding protein from campylobacter jejuni at 2.0 a resolution (see paper)
23% identity, 74% coverage: 26:247/302 of query aligns to 6:217/251 of 1xt8B
6h2tA Glnh bound to glu, mycobacterium tuberculosis (see paper)
22% identity, 85% coverage: 21:276/302 of query aligns to 39:288/288 of 6h2tA
6h20A Glnh bound to asn, mycobacterium tuberculosis (see paper)
22% identity, 85% coverage: 21:276/302 of query aligns to 38:287/287 of 6h20A
6h1uA Glnh bound to asp, mycobacterium tuberculosis (see paper)
22% identity, 85% coverage: 21:276/302 of query aligns to 38:287/287 of 6h1uA
4ohnA Crystal structure of an abc uptake transporter substrate binding protein from streptococcus pneumoniae with bound histidine
20% identity, 79% coverage: 29:268/302 of query aligns to 8:243/246 of 4ohnA
3k4uE Crystal structure of putative binding component of abc transporter from wolinella succinogenes dsm 1740 complexed with lysine
22% identity, 76% coverage: 34:264/302 of query aligns to 4:226/234 of 3k4uE
P02911 Lysine/arginine/ornithine-binding periplasmic protein; LAO-binding protein from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 4 papers)
24% identity, 87% coverage: 1:264/302 of query aligns to 1:253/260 of P02911
4i62A 1.05 angstrom crystal structure of an amino acid abc transporter substrate-binding protein abpa from streptococcus pneumoniae canada mdr_19a bound to l-arginine
21% identity, 80% coverage: 27:268/302 of query aligns to 1:235/237 of 4i62A
>WP_011386136.1 NCBI__GCF_000009985.1:WP_011386136.1
MKPFVLPLFLALAVISTGGAARAEPTLDKVKRTGSVVLGVREASYPLSYLDGDKKPIGYH
VDICRRVTEAVKAQLGLAALEVRTEVVTSKTRIPRLLDGGIDLECGSTTNNAARQTQVAF
APTTYVASVRIAVKKAAHIGKLSQLDGKAVATTAGSTSVQLLKARVQGRDIKVTELFGND
HAESFKMLESDQAAAFVMDDNLLAGLIASSAAPKDYQILPQTLNTEPIAIMLRKGDPEFK
ALVDRTVKAMMESGEVGRLYAKWFQSPIPPMNAALDFPMSPVLLSLIKFPGDDPAEAFRP
EE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory