SitesBLAST
Comparing WP_011386171.1 AMB_RS19325 NAD(P)/FAD-dependent oxidoreductase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 12 hits to proteins with known functional sites (download)
3dmeA Crystal structure of conserved exported protein from bordetella pertussis. Northeast structural genomics target ber141
60% identity, 94% coverage: 15:366/374 of query aligns to 3:358/366 of 3dmeA
- binding flavin-adenine dinucleotide: I8 (= I20), G9 (= G21), G11 (= G23), V12 (= V24), V13 (= V25), E32 (= E44), A33 (= A45), T41 (≠ I53), S42 (= S54), R44 (= R56), N45 (= N57), S46 (= S58), V48 (= V60), H50 (= H62), P170 (= P182), L171 (≠ V183), A203 (= A214), I313 (= I321), R314 (= R322), I346 (= I354), E347 (= E355), S348 (= S356), P349 (= P357), G350 (= G358), L351 (= L359), T352 (= T360)
8w7fB Structure of drosophila melanogaster l-2-hydroxyglutarate dehydrogenase bound with fad and a sulfate ion (see paper)
31% identity, 91% coverage: 33:371/374 of query aligns to 23:403/412 of 8w7fB
- binding flavin-adenine dinucleotide: E34 (= E44), K35 (≠ A45), H42 (≠ G52), Q43 (≠ I53), S44 (= S54), H46 (≠ R56), N47 (= N57), S48 (= S58), V50 (= V60), H52 (= H62), V173 (= V183), G205 (≠ A214), G206 (= G215), Q208 (≠ S217), Y231 (= Y240), V350 (≠ I321), R351 (= R322), P389 (= P357), G390 (= G358), A391 (≠ L359), T392 (= T360)
Sites not aligning to the query:
8w78A Structure of drosophila melanogaster l-2-hydroxyglutarate dehydrogenase in complex with fad and 2-oxoglutarate (see paper)
31% identity, 91% coverage: 33:371/374 of query aligns to 23:401/410 of 8w78A
- binding 2-oxoglutaric acid: S48 (= S58), H52 (= H62), Y245 (= Y254), F254 (≠ G261), L255 (= L262), H258 (= H265), R349 (= R322)
- binding flavin-adenine dinucleotide: E34 (= E44), K35 (≠ A45), H42 (≠ G52), Q43 (≠ I53), S44 (= S54), N47 (= N57), S48 (= S58), V50 (= V60), H52 (= H62), V173 (= V183), G203 (≠ A214), G204 (= G215), Q206 (≠ S217), R349 (= R322), P387 (= P357), G388 (= G358), A389 (≠ L359), T390 (= T360)
Sites not aligning to the query:
4x9mA Oxidized l-alpha-glycerophosphate oxidase from mycoplasma pneumoniae with fad bound (see paper)
26% identity, 97% coverage: 13:373/374 of query aligns to 2:365/384 of 4x9mA
- binding flavin-adenine dinucleotide: G10 (= G21), G12 (= G23), I14 (≠ V25), E33 (= E44), K34 (≠ A45), E41 (≠ G52), T42 (≠ I53), S43 (= S54), A45 (≠ R56), N46 (= N57), S47 (= S58), V49 (= V60), H51 (= H62), E176 (≠ P182), V177 (= V183), A209 (= A214), G210 (= G215), Y212 (≠ S217), Y234 (vs. gap), S319 (≠ I321), R320 (= R322), M346 (≠ I354), K347 (≠ E355), S348 (= S356), P349 (= P357), G350 (= G358), L351 (= L359), T352 (= T360)
- binding sn-glycerol-3-phosphate: S47 (= S58), H51 (= H62), K258 (≠ L262), G259 (= G263), R320 (= R322), S348 (= S356)
P75063 Glycerol 3-phosphate oxidase; GlpO; L-alpha-glycerophosphate oxidase; EC 1.1.3.21 from Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1) (Mycoplasmoides pneumoniae) (see paper)
26% identity, 97% coverage: 13:373/374 of query aligns to 2:365/384 of P75063
Q9UI17 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Homo sapiens (Human) (see 4 papers)
25% identity, 59% coverage: 13:234/374 of query aligns to 48:270/866 of Q9UI17
- CV 59:60 (≠ VV 24:25) binding
- EK 80:81 (≠ AE 45:46) binding
- 87:95 (vs. 52:64, 20% identical) binding
- H91 (= H62) modified: Tele-8alpha-FAD histidine
- H109 (≠ C77) to R: in DMGDHD; shows 10 fold lower catalytic efficiency due to lower cofactor saturation and reduced thermal stability; dbSNP:rs121908331
- V219 (= V183) binding
Sites not aligning to the query:
- 279 S → P: in dbSNP:rs532964
- 397:402 binding
- 530 A → G: in dbSNP:rs1805073
- 646 S → P: in dbSNP:rs1805074
4pabB Crystal structure of the precursor form of rat dmgdh complexed with tetrahydrofolate (see paper)
24% identity, 59% coverage: 13:234/374 of query aligns to 4:226/824 of 4pabB
- active site: T53 (≠ E59), E102 (≠ Q112), H226 (= H234)
- binding flavin-adenine dinucleotide: I11 (= I20), G12 (= G21), G14 (= G23), C15 (≠ V24), V16 (= V25), L35 (≠ E44), E36 (≠ A45), K37 (≠ E46), G43 (= G52), S44 (≠ I53), T45 (≠ S54), H47 (≠ R56), A48 (≠ N57), A49 (vs. gap), G50 (vs. gap), L51 (vs. gap), V175 (= V183), A204 (= A214), G205 (= G215), W207 (≠ S217), H226 (= H234)
Sites not aligning to the query:
- active site: 255, 536
- binding flavin-adenine dinucleotide: 228, 326, 328, 353, 355, 356, 357, 358
- binding (6s)-5,6,7,8-tetrahydrofolate: 523, 536, 538, 550, 612, 613, 632, 639, 680, 700
Q63342 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Rattus norvegicus (Rat) (see 2 papers)
24% identity, 59% coverage: 13:234/374 of query aligns to 41:263/857 of Q63342
- CV 52:53 (≠ VV 24:25) binding
- EK 73:74 (≠ AE 45:46) binding
- 80:88 (vs. 52:57, 11% identical) binding
- H84 (≠ R56) modified: Tele-8alpha-FAD histidine
- V212 (= V183) binding
- W244 (≠ S217) binding
Sites not aligning to the query:
- 390:395 binding
- 573:575 binding
- 669 binding
- 676:678 binding
- 737 binding
Q6TGQ9 L-amino-acid oxidase BjussuLAAO-I; BjsuLAAO; LAO; EC 1.4.3.2 from Bothrops jararacussu (Jararacussu) (see paper)
34% identity, 25% coverage: 1:93/374 of query aligns to 35:120/497 of Q6TGQ9
Sites not aligning to the query:
- 23 modified: Disulfide link with 186
- 186 modified: Disulfide link with 23
- 344 modified: Disulfide link with 425
- 425 modified: Disulfide link with 344
1y56B Crystal structure of l-proline dehydrogenase from p.Horikoshii (see paper)
28% identity, 42% coverage: 30:185/374 of query aligns to 20:173/374 of 1y56B
- active site: F44 (≠ S55), G47 (≠ S58), T48 (≠ E59)
- binding flavin-adenine dinucleotide: I33 (≠ L43), E34 (= E44), K35 (≠ A45), S42 (≠ I53), T43 (≠ S54), R45 (= R56), C46 (≠ N57), G47 (≠ S58), G49 (≠ V60), E170 (≠ P182), V171 (= V183)
- binding flavin mononucleotide: F44 (≠ S55), R45 (= R56)
Sites not aligning to the query:
- active site: 224, 239, 305, 338
- binding flavin-adenine dinucleotide: 11, 13, 14, 15, 200, 201, 203, 305, 306, 307, 334, 335, 336, 337, 338
- binding flavin mononucleotide: 260, 301, 303
5ts5A Crystal structure of l-amino acid oxidase from bothrops atrox (see paper)
36% identity, 23% coverage: 1:87/374 of query aligns to 21:100/483 of 5ts5A
- active site: P91 (≠ V78)
- binding flavin-adenine dinucleotide: V38 (≠ I20), G39 (= G21), S43 (≠ V25), L61 (= L43), E62 (= E44), A63 (= A45), G69 (≠ S51), R70 (≠ G52), G86 (= G70), P87 (≠ S71), R89 (= R73)
Sites not aligning to the query:
- active site: 222, 325
- binding flavin-adenine dinucleotide: 259, 260, 293, 297, 371, 419, 428, 429, 455, 456, 463, 464, 465, 468
- binding zinc ion: 313, 439
P0CC17 L-amino-acid oxidase; BatroxLAAO; LAO; EC 1.4.3.2 from Bothrops atrox (Barba amarilla) (Fer-de-lance) (see 2 papers)
36% identity, 23% coverage: 1:87/374 of query aligns to 40:119/506 of P0CC17
- E111 (= E79) binding
- E118 (≠ D86) binding
Sites not aligning to the query:
- 1:18 signal peptide
- 28 modified: Disulfide link with 191
- 36 binding
- 190 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 191 modified: Disulfide link with 28
- 219 binding
- 248 binding
- 299 binding
- 332 binding
- 349 modified: Disulfide link with 430
- 430 modified: Disulfide link with 349
- 458 binding
Query Sequence
>WP_011386171.1 AMB_RS19325 NAD(P)/FAD-dependent oxidoreductase
MGKNKVLTQSAAERVDCVVIGAGVVGLAVARSLAHAGAEVIILEAEGAIGSGISSRNSEV
IHAGMYYPAGSLRARLCVEGNRLLRDYAASRGVAHAMTGKLIVATDEAEAAQLDAILAKG
RANGVEGLTRISAAHAREMEPDLACVAALWSPATGIIDTHGLMLSLLGEAEERGAALALK
SPVTGGRATDDGMLLSVGGAEPTTLLARNVVLAAGLSSPRLGAALGLKNVPPAHLCKGNY
FTLSGRTPFTRLVYPVPVAAGLGVHFTLDLGGRGRFGPDVEWVEAEDYQVDPRRGDSFYA
AIRRYWPDLADGALEPAYAGIRPKITAEGEPAADFLIHGPRETGVPGVAALYGIESPGLT
SSLAIAGHVGELLA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory