Comparing WP_011386228.1 NCBI__GCF_000009985.1:WP_011386228.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7t1qA Crystal structure of the succinyl-diaminopimelate desuccinylase (dape) from acinetobacter baumannii in complex with succinic acid
46% identity, 95% coverage: 17:377/379 of query aligns to 16:376/377 of 7t1qA
4o23A Crystal structure of mono-zinc form of succinyl diaminopimelate desuccinylase from neisseria meningitidis mc58 (see paper)
45% identity, 97% coverage: 9:377/379 of query aligns to 8:376/376 of 4o23A
4pqaA Crystal structure of succinyl-diaminopimelate desuccinylase from neisseria meningitidis mc58 in complex with the inhibitor captopril (see paper)
45% identity, 97% coverage: 9:375/379 of query aligns to 8:374/375 of 4pqaA
5vo3A Crystal structure of dape in complex with the products (succinic acid and diaminopimelic acid) (see paper)
42% identity, 97% coverage: 7:375/379 of query aligns to 10:378/380 of 5vo3A
P44514 Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 3 papers)
42% identity, 97% coverage: 7:375/379 of query aligns to 6:374/377 of P44514
7lgpB Dape enzyme from shigella flexneri
41% identity, 98% coverage: 7:377/379 of query aligns to 8:377/377 of 7lgpB
4h2kA Crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae (see paper)
46% identity, 46% coverage: 7:182/379 of query aligns to 8:182/258 of 4h2kA
Sites not aligning to the query:
4op4B Crystal structure of the catalytic domain of dape protein from v.Cholerea in the zn bound form (see paper)
47% identity, 46% coverage: 9:182/379 of query aligns to 8:180/265 of 4op4B
Sites not aligning to the query:
7uoiA Crystallographic structure of dape from enterococcus faecium
28% identity, 99% coverage: 1:377/379 of query aligns to 5:383/383 of 7uoiA
7rsfA Acetylornithine deacetylase from escherichia coli
28% identity, 97% coverage: 7:372/379 of query aligns to 6:374/380 of 7rsfA
3pfoA Crystal structure of a putative acetylornithine deacetylase (rpa2325) from rhodopseudomonas palustris cga009 at 1.90 a resolution
26% identity, 58% coverage: 2:219/379 of query aligns to 17:244/426 of 3pfoA
Sites not aligning to the query:
Q8C165 N-fatty-acyl-amino acid synthase/hydrolase PM20D1; Peptidase M20 domain-containing protein 1; PM20D1; EC 3.5.1.114; EC 3.5.1.14 from Mus musculus (Mouse) (see paper)
27% identity, 55% coverage: 71:279/379 of query aligns to 124:383/503 of Q8C165
Sites not aligning to the query:
P37111 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Sus scrofa (Pig) (see paper)
26% identity, 98% coverage: 7:377/379 of query aligns to 13:399/407 of P37111
Sites not aligning to the query:
4mmoA The crystal structure of a m20 family metallo-carboxypeptidase sso-cp2 from sulfolobus solfataricus
27% identity, 55% coverage: 13:219/379 of query aligns to 11:220/437 of 4mmoA
Q03154 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Homo sapiens (Human) (see 6 papers)
25% identity, 96% coverage: 14:377/379 of query aligns to 22:400/408 of Q03154
5xoyA Crystal structure of lysk from thermus thermophilus in complex with lysine (see paper)
25% identity, 98% coverage: 5:376/379 of query aligns to 2:338/341 of 5xoyA
P45494 Beta-Ala-Xaa dipeptidase; Beta-Ala-His dipeptidase; Peptidase V; EC 3.4.13.- from Lactobacillus delbrueckii subsp. lactis (see paper)
35% identity, 29% coverage: 59:167/379 of query aligns to 74:169/470 of P45494
Sites not aligning to the query:
1lfwA Crystal structure of pepv (see paper)
35% identity, 29% coverage: 59:167/379 of query aligns to 74:169/468 of 1lfwA
Sites not aligning to the query:
Q96KN2 Beta-Ala-His dipeptidase; CNDP dipeptidase 1; Carnosine dipeptidase 1; Glutamate carboxypeptidase-like protein 2; Serum carnosinase; EC 3.4.13.20 from Homo sapiens (Human) (see 4 papers)
27% identity, 53% coverage: 6:204/379 of query aligns to 66:275/507 of Q96KN2
Sites not aligning to the query:
3dljA Crystal structure of human carnosine dipeptidase 1
31% identity, 36% coverage: 6:141/379 of query aligns to 37:173/471 of 3dljA
Sites not aligning to the query:
>WP_011386228.1 NCBI__GCF_000009985.1:WP_011386228.1
MSFRDPVPLAQALIRCPSVTPEDAGALDVLAGALEELGFACHHIRSATGGPEIRNLYARL
GTEAPNLCFAGHTDVVPPGKGWTVEPFAAGIDQGRLFGRGSADMKGAIACFVAAVARLLE
DGAPKGSLSLLITGDEEGPAVDGTVKVLDWLAARGERIDCCIVGEPTNPRKLGDMMKIGR
RGSLNCRLTVFGTQGHSAYPHLADNPIPRLLDILRRLTEAPLDEGTPHFQASTLALTTVD
VGNPATNVIPAEARAGFNIRFNDLHSGASLERWIRDTVAQAGGEVEIKVEVSGESFLTPP
GALSDALAEAAFEVTGLRPELSTSGGTSDARFIKNHCPVVEFGLVGQTMHKSDEHVSVAD
MEALTEIYRRVLVRLAAPS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory