SitesBLAST
Comparing WP_011386279.1 NCBI__GCF_000009985.1:WP_011386279.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
U3KRF2 3-dehydroquinate synthase, chloroplastic; EC 4.2.3.4 from Actinidia chinensis var. chinensis (Chinese soft-hair kiwi) (see paper)
48% identity, 98% coverage: 1:364/371 of query aligns to 77:439/445 of U3KRF2
3zokA Structure of 3-dehydroquinate synthase from actinidia chinensis in complex with NAD (see paper)
49% identity, 96% coverage: 8:364/371 of query aligns to 4:359/365 of 3zokA
- active site: R122 (= R125), K144 (= K147), E186 (= E189), K228 (= K231), E238 (= E241), R242 (= R245), N246 (= N249), H249 (= H252), H253 (= H256), H266 (= H270)
- binding glycine: K144 (= K147), K228 (= K231), R242 (= R245)
- binding nicotinamide-adenine-dinucleotide: T44 (≠ N49), V45 (= V50), D73 (≠ A76), E75 (= E78), K78 (= K81), G106 (= G109), G107 (= G110), V108 (= V111), D111 (= D114), T131 (= T134), T132 (= T135), M134 (≠ L137), D138 (= D141), S139 (= S142), K144 (= K147), K153 (= K156), T174 (= T177), L175 (= L178), E179 (≠ Q182), H266 (= H270)
5eksA Structure of 3-dehydroquinate synthase from acinetobacter baumannii in complex with NAD
49% identity, 94% coverage: 6:354/371 of query aligns to 3:339/355 of 5eksA
- active site: R120 (= R125), K142 (= K147), E184 (= E189), K226 (= K231), R237 (= R245), N241 (= N249), H244 (= H252), H248 (= H256), H261 (= H270)
- binding magnesium ion: E184 (= E189), H244 (= H252), H261 (= H270)
- binding nicotinamide-adenine-dinucleotide: N42 (≠ D47), V45 (= V50), D71 (≠ A76), E73 (= E78), K76 (= K81), G104 (= G109), G105 (= G110), V106 (= V111), D109 (= D114), T129 (= T134), T130 (= T135), D136 (= D141), S137 (= S142), K142 (= K147), T172 (= T177), L173 (= L178), E177 (≠ Q182)
Q9KNV2 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
47% identity, 97% coverage: 6:364/371 of query aligns to 2:355/361 of Q9KNV2
3okfA 2.5 angstrom resolution crystal structure of 3-dehydroquinate synthase (arob) from vibrio cholerae
46% identity, 97% coverage: 6:364/371 of query aligns to 3:354/360 of 3okfA
- active site: R120 (= R125), K142 (= K147), E184 (= E189), K226 (= K231), R238 (= R245), N242 (= N249), H245 (= H252), H249 (= H256), H262 (= H270)
- binding nicotinamide-adenine-dinucleotide: N42 (≠ D47), L48 (≠ H53), D71 (≠ A76), E73 (= E78), K76 (= K81), G104 (= G109), G105 (= G110), V106 (= V111), D109 (= D114), T129 (= T134), T130 (= T135), L132 (= L137), D136 (= D141), T172 (= T177), L173 (= L178), E177 (≠ Q182)
6llaB Crystal structure of providencia alcalifaciens 3-dehydroquinate synthase (dhqs) in complex with mg2+ and NAD (see paper)
48% identity, 94% coverage: 6:355/371 of query aligns to 3:349/363 of 6llaB
- active site: R121 (= R125), K143 (= K147), E185 (= E189), K227 (= K231), E237 (= E241), R242 (= R245), N246 (= N249), H249 (= H252), H253 (= H256), H266 (= H270)
- binding magnesium ion: E185 (= E189), H249 (= H252), H266 (= H270)
- binding nicotinamide-adenine-dinucleotide: L46 (≠ V50), D72 (≠ A76), E74 (= E78), K77 (= K81), G105 (= G109), G106 (= G110), V107 (= V111), D110 (= D114), T130 (= T134), T131 (= T135), L133 (= L137), D137 (= D141), K143 (= K147), T173 (= T177), L174 (= L178), E178 (≠ Q182)
6lk2A Crystal structure of providencia alcalifaciens 3-dehydroquinate synthase (dhqs) in complex with mg2+, NAD and chlorogenic acid (see paper)
47% identity, 94% coverage: 6:355/371 of query aligns to 3:345/357 of 6lk2A
- active site: R121 (= R125), K143 (= K147), E185 (= E189), K227 (= K231), R238 (= R245), N242 (= N249), H245 (= H252), H249 (= H256), H262 (= H270)
- binding (1R,3R,4S,5R)-3-[3-[3,4-bis(oxidanyl)phenyl]propanoyloxy]-1,4,5-tris(oxidanyl)cyclohexane-1-carboxylic acid: D137 (= D141), E185 (= E189), K227 (= K231), R238 (= R245), N242 (= N249), H245 (= H252), T246 (= T253), H249 (= H256), H262 (= H270)
- binding magnesium ion: E185 (= E189), H245 (= H252), H262 (= H270)
- binding nicotinamide-adenine-dinucleotide: L46 (≠ V50), D72 (≠ A76), E74 (= E78), K77 (= K81), G105 (= G109), G106 (= G110), V107 (= V111), D110 (= D114), T130 (= T134), T131 (= T135), L133 (= L137), D137 (= D141), S138 (= S142), C170 (≠ V174), T173 (= T177), L174 (= L178), P175 (= P179), E178 (≠ Q182)
Q5NFS1 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
42% identity, 83% coverage: 41:347/371 of query aligns to 36:339/359 of Q5NFS1
P56081 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) (see paper)
38% identity, 97% coverage: 6:364/371 of query aligns to 2:339/343 of P56081
5hvnA 3.0 angstrom crystal structure of 3-dehydroquinate synthase (arob) from francisella tularensis in complex with NAD.
41% identity, 83% coverage: 41:347/371 of query aligns to 39:334/354 of 5hvnA
- active site: R123 (= R125), K145 (= K147), E187 (= E189), K228 (= K231), R239 (= R245), N243 (= N249), H246 (= H252), H250 (= H256), H263 (= H270)
- binding nicotinamide-adenine-dinucleotide: N45 (≠ D47), L51 (≠ H53), D73 (≠ A76), E75 (= E78), K78 (= K81), G107 (= G109), G108 (= G110), V109 (= V111), D112 (= D114), T132 (= T134), T133 (= T135), L135 (= L137), D139 (= D141), K145 (= K147), F172 (≠ V174), T175 (= T177), L176 (= L178), E180 (≠ Q182)
1dqsA Crystal structure of dehydroquinate synthase (dhqs) complexed with carbaphosphonate, NAD+ and zn2+ (see paper)
41% identity, 84% coverage: 43:353/371 of query aligns to 37:368/381 of 1dqsA
- active site: R127 (= R125), K149 (= K147), E191 (= E189), K240 (= K231), E250 (= E241), R254 (= R245), N258 (= N249), H261 (= H252), H265 (= H256), H277 (= H270)
- binding [1r-(1alpha,3beta,4alpha,5beta)]-5-(phosphonomethyl)-1,3,4-trihydroxycyclohexane-1-carboxylic acid: D143 (= D141), K149 (= K147), N159 (= N157), E191 (= E189), K240 (= K231), R254 (= R245), L257 (= L248), N258 (= N249), H261 (= H252), H265 (= H256), H277 (= H270), K346 (= K331)
- binding nicotinamide-adenine-dinucleotide: D41 (= D47), N43 (= N49), I44 (≠ V50), E78 (= E78), K81 (= K81), G111 (= G109), G112 (= G110), V113 (= V111), D116 (= D114), T136 (= T134), T137 (= T135), L139 (= L137), D143 (= D141), S144 (= S142), K158 (= K156), T179 (= T177), P181 (= P179), E184 (≠ Q182), H277 (= H270)
- binding zinc ion: E191 (= E189), H261 (= H252), H277 (= H270)
1nvbB Crystal structure of 3-dehydroquinate synthase (dhqs) in complex with zn2+ and carbaphosphonate (see paper)
40% identity, 84% coverage: 43:353/371 of query aligns to 38:376/391 of 1nvbB
- active site: R128 (= R125), K150 (= K147), E192 (= E189), K248 (= K231), E258 (= E241), R262 (= R245), N266 (= N249), H269 (= H252), H273 (= H256), H285 (= H270)
- binding [1r-(1alpha,3beta,4alpha,5beta)]-5-(phosphonomethyl)-1,3,4-trihydroxycyclohexane-1-carboxylic acid: D144 (= D141), K150 (= K147), N160 (= N157), E192 (= E189), K248 (= K231), R262 (= R245), L265 (= L248), N266 (= N249), H269 (= H252), H273 (= H256), K354 (= K331)
- binding zinc ion: E192 (= E189), H269 (= H252), H285 (= H270)
P07547 Pentafunctional AROM polypeptide; EC 4.2.3.4; EC 2.5.1.19; EC 2.7.1.71; EC 4.2.1.10; EC 1.1.1.25 from Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans) (see 2 papers)
40% identity, 84% coverage: 43:353/371 of query aligns to 40:378/1583 of P07547
6hqvA Pentafunctional arom complex from chaetomium thermophilum (see paper)
40% identity, 83% coverage: 43:350/371 of query aligns to 38:368/1555 of 6hqvA
- active site: R123 (= R125), K145 (= K147), E187 (= E189), K243 (= K231), E253 (= E241), R257 (= R245), N261 (= N249), H264 (= H252), H268 (= H256), H280 (= H270)
- binding glutamic acid: D139 (= D141), K145 (= K147), E187 (= E189), K243 (= K231), R257 (= R245), H264 (= H252), H280 (= H270)
- binding nicotinamide-adenine-dinucleotide: D42 (= D47), N44 (= N49), L45 (≠ V50), E76 (= E78), K79 (= K81), G107 (= G109), G108 (= G110), V109 (= V111), D112 (= D114), T132 (= T134), T133 (= T135), L135 (= L137), D139 (= D141), S140 (= S142), K145 (= K147), K154 (= K156), T175 (= T177), L176 (= L178), P177 (= P179), E180 (≠ Q182), H280 (= H270)
- binding zinc ion: E187 (= E189), H264 (= H252), H280 (= H270)
Sites not aligning to the query:
- binding (4S,5R)-4,5-dihydroxy-3-oxocyclohex-1-ene-1-carboxylic acid: 1060, 1062, 1181, 1224, 1232, 1242, 1243
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: 413, 562, 563, 874, 923, 924, 979, 1277, 1279, 1323, 1327, 1348, 1368, 1526
6c5cA Crystal structure of the 3-dehydroquinate synthase (dhqs) domain of aro1 from candida albicans sc5314 in complex with nadh (see paper)
39% identity, 89% coverage: 19:350/371 of query aligns to 17:368/385 of 6c5cA
- active site: R130 (= R125), K152 (= K147), E194 (= E189), K246 (= K231), E254 (= E241), R258 (= R245), N262 (= N249), H265 (= H252), H269 (= H256), H281 (= H270)
- binding nicotinamide-adenine-dinucleotide: D45 (= D47), N47 (= N49), M48 (≠ V50), E83 (= E78), K86 (= K81), G114 (= G109), G115 (= G110), V116 (= V111), D119 (= D114), T139 (= T134), T140 (= T135), D146 (= D141), S147 (= S142), F179 (≠ V174), T182 (= T177), L183 (= L178), Q187 (= Q182)
3clhA Crystal structure of 3-dehydroquinate synthase (dhqs)from helicobacter pylori (see paper)
41% identity, 83% coverage: 8:314/371 of query aligns to 1:284/308 of 3clhA
- active site: R107 (= R125), K129 (= K147), E171 (= E189), K207 (= K231), R212 (= R245), N216 (= N249), H219 (= H252), H223 (= H256), H236 (= H270)
- binding nicotinamide-adenine-dinucleotide: I33 (≠ N49), V34 (= V50), H38 (vs. gap), S58 (≠ A76), E60 (= E78), K63 (= K81), G91 (= G109), G92 (= G110), V93 (= V111), D96 (= D114), T116 (= T134), T117 (= T135), L119 (= L137), D123 (= D141), A124 (≠ S142), K129 (= K147), N139 (= N157), T159 (= T177), L160 (= L178), E164 (≠ Q182)
Q6GGU4 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Staphylococcus aureus (strain MRSA252) (see paper)
35% identity, 90% coverage: 15:347/371 of query aligns to 10:330/354 of Q6GGU4
1xagA Crystal structure of staphlyococcus aureus 3-dehydroquinate synthase (dhqs) in complex with zn2+, NAD+ and carbaphosphonate (see paper)
35% identity, 90% coverage: 15:347/371 of query aligns to 10:330/353 of 1xagA
- active site: R115 (= R125), K136 (= K147), E178 (= E189), K221 (= K231), E231 (= E241), R235 (= R245), N239 (= N249), H242 (= H252), H246 (= H256), H256 (= H270)
- binding [1r-(1alpha,3beta,4alpha,5beta)]-5-(phosphonomethyl)-1,3,4-trihydroxycyclohexane-1-carboxylic acid: K136 (= K147), N146 (= N157), E178 (= E189), K221 (= K231), R235 (= R245), L238 (= L248), N239 (= N249), H242 (= H252), H246 (= H256), K314 (= K331)
- binding nicotinamide-adenine-dinucleotide: D39 (= D47), Y41 (≠ N49), V42 (= V50), Y45 (≠ H53), E68 (= E78), K71 (= K81), G99 (= G109), G100 (= G110), A101 (≠ V111), D104 (= D114), T124 (= T134), T125 (= T135), L127 (= L137), D130 (= D141), S131 (= S142), K136 (= K147), K145 (= K156), T166 (= T177), L167 (= L178), Q171 (= Q182), H256 (= H270)
- binding zinc ion: E178 (= E189), H242 (= H252), H256 (= H270)
1nvaA Crystal structure of 3-dehydroquinate synthase (dhqs) in complex with zn2+ and adp (see paper)
39% identity, 84% coverage: 43:353/371 of query aligns to 37:366/380 of 1nvaA
- active site: R127 (= R125), K149 (= K147), E191 (= E189), K247 (= K231), R257 (= R245), N261 (= N249), H264 (= H252), H268 (= H256), H280 (= H270)
- binding adenosine-5'-diphosphate: D41 (= D47), N43 (= N49), G111 (= G109), G112 (= G110), T136 (= T134), T137 (= T135), F176 (≠ V174), T179 (= T177), L180 (= L178)
- binding zinc ion: E191 (= E189), H264 (= H252), H280 (= H270)
P9WPX9 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
39% identity, 79% coverage: 56:348/371 of query aligns to 53:340/362 of P9WPX9
Sites not aligning to the query:
Query Sequence
>WP_011386279.1 NCBI__GCF_000009985.1:WP_011386279.1
MSAAAEEVMVELGERSYPIHIGPGLLDRAGELIKPKMRGGRALVVTDANVAPHYLERVQK
SLAEAGVTTMHTVMPAGEQTKDFKHLEALLDAMLEARSERGIMVVALGGGVVGDLTGFAA
SILLRGVDFVQIPTTLLSQVDSSVGGKTGINTRQGKNLIGSFYQPRLVLADTSVLNTLPR
RQVLAGYAEVAKYGVIDDEPFFAWLEENGSKVVDGDLEARRYAVATSCRAKARIVGADER
EGGVRALLNLGHTFGHALEAETGFSEEMLHGEAVAIGMVMALRLSARLGLAPAADAERLE
RHLLAVGLPVTLPKPRLWAVDRLIHHMAGDKKVKDGKVTFVMAKGIGKSFLTRDVPEAEL
ASMLAEMASGY
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory