Comparing WP_011386430.1 NCBI__GCF_000009985.1:WP_011386430.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2j5tD Glutamate 5-kinase from escherichia coli complexed with glutamate (see paper)
42% identity, 98% coverage: 7:367/370 of query aligns to 2:363/365 of 2j5tD
P0A7B5 Glutamate 5-kinase; Gamma-glutamyl kinase; GK; EC 2.7.2.11 from Escherichia coli (strain K12) (see paper)
42% identity, 98% coverage: 4:367/370 of query aligns to 1:365/367 of P0A7B5
2j5vB Glutamate 5-kinase from escherichia coli complexed with glutamyl-5- phosphate and pyroglutamic acid (see paper)
37% identity, 98% coverage: 7:367/370 of query aligns to 2:323/325 of 2j5vB
2j5vA Glutamate 5-kinase from escherichia coli complexed with glutamyl-5- phosphate and pyroglutamic acid (see paper)
37% identity, 98% coverage: 7:367/370 of query aligns to 2:321/323 of 2j5vA
2akoA Crystal structure of glutamate 5-kinase from campylobacter jejuni
34% identity, 65% coverage: 8:248/370 of query aligns to 1:228/241 of 2akoA
7wx3B Gk domain of drosophila p5cs filament with glutamate, atp, and NADPH (see paper)
35% identity, 69% coverage: 2:258/370 of query aligns to 7:256/258 of 7wx3B
7f5xA Gk domain of drosophila p5cs filament with glutamate (see paper)
37% identity, 55% coverage: 2:203/370 of query aligns to 7:199/236 of 7f5xA
Q8U122 Uridylate kinase; UK; Uridine monophosphate kinase; UMP kinase; UMPK; EC 2.7.4.22 from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) (see paper)
33% identity, 24% coverage: 152:240/370 of query aligns to 120:205/225 of Q8U122
Sites not aligning to the query:
2bmuB Ump kinase from pyrococcus furiosus complexed with its substrate ump and its substrate analog amppnp (see paper)
33% identity, 24% coverage: 152:240/370 of query aligns to 121:206/226 of 2bmuB
Sites not aligning to the query:
2ji5A Structure of ump kinase from pyrococcus furiosus complexed with utp
43% identity, 13% coverage: 152:200/370 of query aligns to 122:167/219 of 2ji5A
Sites not aligning to the query:
O60163 Probable aspartokinase; Aspartate kinase; EC 2.7.2.4 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
38% identity, 22% coverage: 145:226/370 of query aligns to 221:299/519 of O60163
Sites not aligning to the query:
8u0lA Isopentenyl phosphate kinase (see paper)
22% identity, 50% coverage: 10:195/370 of query aligns to 3:192/247 of 8u0lA
Sites not aligning to the query:
8u0kA Isopentenyl phosphate kinase (see paper)
22% identity, 50% coverage: 10:195/370 of query aligns to 3:192/247 of 8u0kA
Sites not aligning to the query:
7lnuA Ternary complex of the isopentenyl phosphate kinase from candidatus methanomethylophilus alvus bound to isopentenyl monophosphate and atp (see paper)
26% identity, 53% coverage: 10:204/370 of query aligns to 4:200/239 of 7lnuA
8u0mA Isopentenyl phosphate kinase (see paper)
21% identity, 54% coverage: 10:207/370 of query aligns to 3:205/247 of 8u0mA
Sites not aligning to the query:
7lntA Ternary complex of the isopentenyl phosphate kinase from candidatus methanomethylophilus alvus bound to benzyl monophosphate and atp (see paper)
26% identity, 53% coverage: 10:204/370 of query aligns to 4:200/238 of 7lntA
7n9dA I74a mutant of the isopentenyl phosphate kinase from candidatus methanomethylophilus alvus (see paper)
26% identity, 50% coverage: 10:194/370 of query aligns to 3:192/253 of 7n9dA
Sites not aligning to the query:
3c1mC Cyrstal structure of threonine-sensitive aspartokinase from methanococcus jannaschii with mgamp-pnp and l-aspartate (see paper)
34% identity, 25% coverage: 114:204/370 of query aligns to 167:257/468 of 3c1mC
Sites not aligning to the query:
3c1nA Crystal structure of allosteric inhibition threonine-sensitive aspartokinase from methanococcus jannaschii with l-threonine (see paper)
34% identity, 25% coverage: 114:204/370 of query aligns to 166:256/458 of 3c1nA
Sites not aligning to the query:
2hmfA Structure of a threonine sensitive aspartokinase from methanococcus jannaschii complexed with mg-adp and aspartate (see paper)
34% identity, 25% coverage: 114:204/370 of query aligns to 167:257/464 of 2hmfA
Sites not aligning to the query:
>WP_011386430.1 NCBI__GCF_000009985.1:WP_011386430.1
MSPLAAAKRLIVKIGSSLLVDDSTGQVRRGWLETLAADIAACKARGQEVIVVSSGAVAVG
RRKLGLVPPLKLEEKQAAAATGQIRLAHAWQDALAHHQITVAQVLLTLDDSENRRRYLNA
RSTLETLLKLGAVPVINENDTVATAEIRVGDNDRLAARVAQMVSADALVLFSDIDGLYTA
DPRKDPDARFIPEVHELTPEIEAMAGDPGSAYGSGGMVTKLVAARICLSAGCRMAITRGE
PMHPLKTIEDGGRCTWFLPNSEPRTARKQWIFGSMKPTGTLVLDAGAARALAQGRSLLPA
GITEVSGAFERGDCVLVKDGSGKVLGRGLVAYSADDSRAIMGRKSGEIEAILGFRGRDEL
IHRDDLVMEG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory