Comparing WP_011386456.1 NCBI__GCF_000009985.1:WP_011386456.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4isdA Crystal structure of glutathione transferase homolog from burkholderia gl bgr1, target efi-501803, with bound glutathione
29% identity, 99% coverage: 3:207/208 of query aligns to 5:187/187 of 4isdA
4jbbA Crystal structure of glutathione s-transferase a6tby7(target efi- 507184) from klebsiella pneumoniae mgh 78578, gsh complex
27% identity, 82% coverage: 3:173/208 of query aligns to 4:176/208 of 4jbbA
P77544 Glutathione S-transferase YfcF; EC 2.5.1.18 from Escherichia coli (strain K12) (see paper)
30% identity, 83% coverage: 2:173/208 of query aligns to 5:178/214 of P77544
O43708 Maleylacetoacetate isomerase; MAAI; GSTZ1-1; Glutathione S-transferase zeta 1; EC 5.2.1.2; EC 2.5.1.18 from Homo sapiens (Human) (see 10 papers)
36% identity, 48% coverage: 13:111/208 of query aligns to 14:115/216 of O43708
Sites not aligning to the query:
Q9WVL0 Maleylacetoacetate isomerase; MAAI; GSTZ1-1; Glutathione S-transferase zeta 1; EC 5.2.1.2; EC 2.5.1.18 from Mus musculus (Mouse)
36% identity, 48% coverage: 13:111/208 of query aligns to 14:115/216 of Q9WVL0
2cz2A Crystal structure of glutathione transferase zeta 1-1 (maleylacetoacetate isomerase) from mus musculus (form-1 crystal)
36% identity, 48% coverage: 13:111/208 of query aligns to 11:112/212 of 2cz2A
Sites not aligning to the query:
1fw1A Glutathione transferase zeta/maleylacetoacetate isomerase (see paper)
35% identity, 48% coverage: 13:111/208 of query aligns to 10:111/208 of 1fw1A
Sites not aligning to the query:
3bbyA Crystal structure of glutathione s-transferase (np_416804.1) from escherichia coli k12 at 1.85 a resolution
29% identity, 83% coverage: 2:173/208 of query aligns to 3:158/191 of 3bbyA
3qawA Crystal structure of a glutathione-s-transferase from antarctic clam laternula elliptica in a complex with glutathione (see paper)
26% identity, 89% coverage: 12:197/208 of query aligns to 7:198/219 of 3qawA
1f2eA Structure of sphingomonad, glutathione s-transferase complexed with glutathione
31% identity, 88% coverage: 16:199/208 of query aligns to 11:193/201 of 1f2eA
Sites not aligning to the query:
6m1tA Bacterial beta class sphingomonas chungbukensis glutathione s- transferase
38% identity, 45% coverage: 16:109/208 of query aligns to 11:112/201 of 6m1tA
Sites not aligning to the query:
Q64471 Glutathione S-transferase theta-1; GST class-theta-1; EC 2.5.1.18 from Mus musculus (Mouse) (see paper)
27% identity, 84% coverage: 26:200/208 of query aligns to 24:194/240 of Q64471
Sites not aligning to the query:
4pxoA Crystal structure of maleylacetoacetate isomerase from methylobacteriu extorquens am1 with bound malonate and gsh (target efi-507068)
32% identity, 51% coverage: 10:116/208 of query aligns to 4:120/216 of 4pxoA
3vlnA Human glutathione transferase o1-1 c32s mutant in complex with ascorbic acid (see paper)
24% identity, 72% coverage: 4:152/208 of query aligns to 21:166/239 of 3vlnA
6mhbA Glutathione s-transferase omega 1 bound to covalent inhibitor 18 (see paper)
23% identity, 72% coverage: 4:152/208 of query aligns to 18:160/233 of 6mhbA
Sites not aligning to the query:
4yquA Glutathione s-transferase omega 1 bound to covalent inhibitor c1-31 (see paper)
23% identity, 72% coverage: 4:152/208 of query aligns to 20:162/235 of 4yquA
Sites not aligning to the query:
1jlvA Anopheles dirus species b glutathione s-transferases 1-3 (see paper)
41% identity, 26% coverage: 43:97/208 of query aligns to 40:95/207 of 1jlvA
Sites not aligning to the query:
4is0A Structural insights into omega-class glutathione transferases: a snapshot of enzyme reduction and identification of the non-catalytic ligandin site. (see paper)
23% identity, 72% coverage: 4:152/208 of query aligns to 20:165/238 of 4is0A
Sites not aligning to the query:
7rhpA Crystal structure of honeybee (apis mellifera) glutathione s- transferase amgstd1 (see paper)
33% identity, 37% coverage: 22:97/208 of query aligns to 21:102/215 of 7rhpA
6mhdA Glutathione s-transferase omega 1 bound to covalent inhibitor 44 (see paper)
23% identity, 72% coverage: 4:152/208 of query aligns to 26:171/244 of 6mhdA
Sites not aligning to the query:
>WP_011386456.1 NCBI__GCF_000009985.1:WP_011386456.1
MSLTLVVGTKRWSSWSLRAWMALAVTGAPFRQVFIELRQPETKARILEWSPSGKIPMLDD
DGIKVWDSLAICEYLAERFPGAKLWPDDREARALARSVSAEMHAGFVPLRSTCPMDVVED
HPMAEIPDDVKADVARVDALWTECRTRFGQGGPYLFGAFTNADAMYAPVVTRIRTYNLPV
GPVAGAYCDAIMAHPALQAWVMEARIAG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory