Comparing WP_011386476.1 NCBI__GCF_000009985.1:WP_011386476.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
O33341 Putative glutamine amidotransferase Rv2859c; EC 2.4.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
44% identity, 100% coverage: 1:236/237 of query aligns to 61:295/308 of O33341
7d50B Spua mutant - h221n with glutamyl-thioester (see paper)
36% identity, 97% coverage: 6:236/237 of query aligns to 10:248/255 of 7d50B
7d53A Spua mutant - h221n with glu (see paper)
36% identity, 97% coverage: 6:236/237 of query aligns to 4:242/249 of 7d53A
3fijA Crystal structure of a uncharacterized protein lin1909
36% identity, 88% coverage: 29:237/237 of query aligns to 10:221/224 of 3fijA
P76038 Gamma-glutamyl-gamma-aminobutyrate hydrolase PuuD; Gamma-Glu-GABA hydrolase; EC 3.5.1.94 from Escherichia coli (strain K12) (see paper)
32% identity, 98% coverage: 6:237/237 of query aligns to 8:245/254 of P76038
6vtvB Crystal structure of puud gamma-glutamyl-gamma-aminobutyrate hydrolase from e. Coli
32% identity, 98% coverage: 6:237/237 of query aligns to 6:243/252 of 6vtvB
7d4rB Spua native structure (see paper)
34% identity, 97% coverage: 6:236/237 of query aligns to 2:210/215 of 7d4rB
1vcnA Crystal structure of t.Th. Hb8 ctp synthetase complex with sulfate anion (see paper)
28% identity, 51% coverage: 102:223/237 of query aligns to 353:488/506 of 1vcnA
Sites not aligning to the query:
>WP_011386476.1 NCBI__GCF_000009985.1:WP_011386476.1
MSFSPPLIGITLDSEEPGGYSRMPWYALRRNYAETVARAGGLPVLLPHEPRLAASFLDRI
DGLVVTGGAFDIDPALFGAEARAGLVLKRGRTEFELAMVRGALERDMPILGICGGQQLLN
VALGGTLIQHIPDEVNGALSHEQPTPRSEPGHWVEIASGTRLAEIVGETRIPVNSAHHQA
VRMVAPGCVVNAIAPDGVIEGIEAAGRTFCIGVQWHPEYDISPADSALLRAFVGACR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory