SitesBLAST
Comparing WP_011386482.1 NCBI__GCF_000009985.1:WP_011386482.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7borA Structure of pseudomonas aeruginosa coa-bound odaa (see paper)
42% identity, 96% coverage: 2:245/254 of query aligns to 1:247/247 of 7borA
- active site: N63 (= N64), F68 (= F69), D77 (≠ G77), G81 (≠ D81), I105 (= I105), T108 (= T108), F128 (= F128), L133 (≠ I133), P135 (= P135), E136 (= E136), A222 (≠ T220), L232 (= L230)
- binding coenzyme a: D21 (= D22), K22 (= K23), A25 (= A26), S61 (≠ A62), I65 (≠ L66), V103 (≠ I103), F128 (= F128), L131 (= L131), F244 (= F242), R247 (≠ K245)
6slbAAA Enoyl-CoA hydratase/carnithine racemase (see paper)
37% identity, 98% coverage: 4:251/254 of query aligns to 4:255/257 of 6slbAAA
- active site: Q64 (≠ N64), F69 (= F69), L80 (≠ G77), N84 (≠ D81), A108 (≠ I105), S111 (≠ T108), A130 (≠ P127), F131 (= F128), L136 (≠ I133), P138 (= P135), D139 (≠ E136), A224 (≠ T220), G234 (≠ L230)
- binding (~{E})-6-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethylsulfanyl]-6-oxidanylidene-hex-3-enoic acid: R58 (≠ T58), A62 (= A62), Q64 (≠ N64), D65 (= D65), L66 (= L66), Y76 (≠ W72), A108 (≠ I105), F131 (= F128), D139 (≠ E136)
6slaAAA Enoyl-CoA hydratase/carnithine racemase (see paper)
36% identity, 98% coverage: 4:251/254 of query aligns to 1:243/245 of 6slaAAA
- active site: Q61 (≠ N64), L68 (≠ T71), N72 (≠ D81), A96 (≠ I105), S99 (≠ T108), A118 (≠ P127), F119 (= F128), L124 (≠ I133), P126 (= P135), N127 (≠ E136), A212 (≠ T220), G222 (≠ L230)
- binding ~{S}-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethyl] 2-(2,5-dihydrooxepin-7-yl)ethanethioate: L21 (≠ K24), A59 (= A62), Q61 (≠ N64), D62 (= D65), L63 (= L66), L68 (≠ T71), Y71 (≠ A74), A94 (≠ I103), G95 (= G104), A96 (≠ I105), F119 (= F128), I122 (≠ L131), L124 (≠ I133), N127 (≠ E136), F234 (= F242), K237 (= K245)
5zaiC Crystal structure of 3-hydroxypropionyl-coa dehydratase from metallosphaera sedula (see paper)
35% identity, 98% coverage: 3:251/254 of query aligns to 4:257/259 of 5zaiC
- active site: A65 (≠ N64), F70 (= F69), S82 (= S78), R86 (= R82), G110 (≠ I105), E113 (≠ T108), P132 (= P127), E133 (≠ F128), I138 (= I133), P140 (= P135), G141 (≠ E136), A226 (≠ T220), F236 (≠ L230)
- binding coenzyme a: K24 (= K23), L25 (≠ K24), A63 (= A62), G64 (= G63), A65 (≠ N64), D66 (= D65), I67 (≠ L66), P132 (= P127), R166 (≠ P161), F248 (= F242), K251 (= K245)
3h81A Crystal structure of enoyl-coa hydratase from mycobacterium tuberculosis (see paper)
31% identity, 98% coverage: 3:251/254 of query aligns to 3:254/256 of 3h81A
- active site: A64 (≠ N64), M69 (≠ F69), T79 (≠ V79), F83 (= F83), G107 (≠ I105), E110 (≠ T108), P129 (= P127), E130 (≠ F128), V135 (≠ I133), P137 (= P135), G138 (≠ E136), L223 (≠ T220), F233 (≠ L230)
- binding calcium ion: F233 (≠ L230), Q238 (≠ L235)
3q0jC Crystal structure of the mycobacterium tuberculosis crotonase in complex with the inhibitor acetoacetylcoa
31% identity, 98% coverage: 3:251/254 of query aligns to 4:255/255 of 3q0jC
- active site: A65 (≠ N64), M70 (≠ F69), T80 (≠ V79), F84 (= F83), G108 (≠ I105), E111 (≠ T108), P130 (= P127), E131 (≠ F128), V136 (≠ I133), P138 (= P135), G139 (≠ E136), L224 (≠ T220), F234 (≠ L230)
- binding acetoacetyl-coenzyme a: Q23 (≠ D22), A24 (≠ K23), L25 (≠ K24), A27 (= A26), A63 (= A62), G64 (= G63), A65 (≠ N64), D66 (= D65), I67 (≠ L66), K68 (≠ P67), M70 (≠ F69), F84 (= F83), G107 (= G104), G108 (≠ I105), E111 (≠ T108), P130 (= P127), E131 (≠ F128), P138 (= P135), G139 (≠ E136), M140 (≠ A137)
3q0gC Crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa
31% identity, 98% coverage: 3:251/254 of query aligns to 4:255/255 of 3q0gC
- active site: A65 (≠ N64), M70 (≠ F69), T80 (≠ V79), F84 (= F83), G108 (≠ I105), E111 (≠ T108), P130 (= P127), E131 (≠ F128), V136 (≠ I133), P138 (= P135), G139 (≠ E136), L224 (≠ T220), F234 (≠ L230)
- binding coenzyme a: L25 (≠ K24), A63 (= A62), I67 (≠ L66), K68 (≠ P67), Y104 (≠ A101), P130 (= P127), E131 (≠ F128), L134 (= L131)
1ey3A Structure of enoyl-coa hydratase complexed with the substrate dac-coa (see paper)
29% identity, 94% coverage: 13:250/254 of query aligns to 15:255/258 of 1ey3A
- active site: A66 (≠ N64), M71 (≠ L70), S81 (≠ A80), L85 (≠ I84), G109 (≠ I105), E112 (≠ T108), P131 (= P127), E132 (≠ F128), T137 (≠ I133), P139 (= P135), G140 (≠ E136), K225 (≠ R221), F235 (≠ L230)
- binding 4-(n,n-dimethylamino)cinnamoyl-coa: K24 (≠ D22), L26 (≠ K24), A28 (= A26), A64 (= A62), G65 (= G63), A66 (≠ N64), D67 (= D65), I68 (≠ L66), L85 (≠ I84), W88 (vs. gap), G109 (≠ I105), P131 (= P127), L135 (= L131), G140 (≠ E136)
1dubA 2-enoyl-coa hydratase, data collected at 100 k, ph 6.5 (see paper)
29% identity, 94% coverage: 13:250/254 of query aligns to 17:257/260 of 1dubA
- active site: A68 (≠ N64), M73 (≠ L70), S83 (≠ A80), L87 (≠ I84), G111 (≠ I105), E114 (≠ T108), P133 (= P127), E134 (≠ F128), T139 (≠ I133), P141 (= P135), G142 (≠ E136), K227 (≠ R221), F237 (≠ L230)
- binding acetoacetyl-coenzyme a: K26 (≠ D22), A27 (≠ K23), L28 (≠ K24), A30 (= A26), A66 (= A62), A68 (≠ N64), D69 (= D65), I70 (≠ L66), Y107 (≠ A101), G110 (= G104), G111 (≠ I105), E114 (≠ T108), P133 (= P127), E134 (≠ F128), L137 (= L131), G142 (≠ E136), F233 (= F226), F249 (= F242)
1mj3A Crystal structure analysis of rat enoyl-coa hydratase in complex with hexadienoyl-coa (see paper)
31% identity, 94% coverage: 13:250/254 of query aligns to 17:255/258 of 1mj3A
- active site: A68 (≠ N64), M73 (≠ F69), S83 (= S76), L85 (vs. gap), G109 (≠ I105), E112 (≠ T108), P131 (= P127), E132 (≠ F128), T137 (≠ I133), P139 (= P135), G140 (≠ E136), K225 (≠ R221), F235 (≠ L230)
- binding hexanoyl-coenzyme a: K26 (≠ D22), A27 (≠ K23), L28 (≠ K24), A30 (= A26), A66 (= A62), G67 (= G63), A68 (≠ N64), D69 (= D65), I70 (≠ L66), G109 (≠ I105), P131 (= P127), E132 (≠ F128), L135 (= L131), G140 (≠ E136)
P14604 Enoyl-CoA hydratase, mitochondrial; mECH; mECH1; Enoyl-CoA hydratase 1; ECHS1; Short-chain enoyl-CoA hydratase; SCEH; EC 4.2.1.17; EC 5.3.3.8 from Rattus norvegicus (Rat) (see 3 papers)
29% identity, 94% coverage: 13:250/254 of query aligns to 47:287/290 of P14604
- E144 (≠ T108) mutation to D: Reduces activity 50-fold.; mutation to Q: Reduces activity 3300-fold.
- E164 (≠ F128) mutation to D: Reduces activity 1250-fold.; mutation to Q: Reduces activity 330000-fold.
Sites not aligning to the query:
- 1:29 modified: transit peptide, Mitochondrion
3q0gD Crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa
30% identity, 98% coverage: 3:251/254 of query aligns to 3:250/250 of 3q0gD
- active site: A64 (≠ N64), M69 (vs. gap), T75 (vs. gap), F79 (= F69), G103 (≠ I105), E106 (≠ T108), P125 (= P127), E126 (≠ F128), V131 (≠ I133), P133 (= P135), G134 (≠ E136), L219 (≠ T220), F229 (≠ L230)
- binding Butyryl Coenzyme A: F225 (= F226), F241 (= F242)
2dubA Enoyl-coa hydratase complexed with octanoyl-coa (see paper)
31% identity, 94% coverage: 13:250/254 of query aligns to 16:251/254 of 2dubA
- active site: A67 (≠ N64), M72 (≠ F69), S82 (= S78), G105 (≠ I105), E108 (≠ T108), P127 (= P127), E128 (≠ F128), T133 (≠ I133), P135 (= P135), G136 (≠ E136), K221 (≠ R221), F231 (≠ L230)
- binding octanoyl-coenzyme a: K25 (≠ D22), A26 (≠ K23), L27 (≠ K24), A29 (= A26), A65 (= A62), A67 (≠ N64), D68 (= D65), I69 (≠ L66), K70 (≠ P67), G105 (≠ I105), E108 (≠ T108), P127 (= P127), E128 (≠ F128), G136 (≠ E136), A137 (= A137)
2hw5C The crystal structure of human enoyl-coenzyme a (coa) hydratase short chain 1, echs1
29% identity, 94% coverage: 13:250/254 of query aligns to 17:257/260 of 2hw5C
- active site: A68 (≠ N64), M73 (≠ F69), S83 (≠ G77), L87 (≠ D81), G111 (≠ I105), E114 (≠ T108), P133 (= P127), E134 (≠ F128), T139 (≠ I133), P141 (= P135), G142 (≠ E136), K227 (≠ R221), F237 (≠ L230)
- binding crotonyl coenzyme a: K26 (≠ D22), A27 (≠ K23), L28 (≠ K24), A30 (= A26), K62 (≠ T58), I70 (≠ L66), F109 (≠ I103)
6p5uE Structure of an enoyl-coa hydratase/aldolase isolated from a lignin- degrading consortium (see paper)
32% identity, 85% coverage: 8:222/254 of query aligns to 11:233/246 of 6p5uE
- active site: M67 (≠ N64), Y72 (≠ F69), D77 (≠ A74), R89 (≠ A86), A93 (= A90), G117 (≠ I105), T120 (= T108), E140 (≠ F128), I145 (= I133), P147 (= P135), A148 (≠ E136)
- binding coenzyme a: D25 (= D22), K26 (= K23), R27 (≠ K24), A29 (= A26), A65 (= A62), M67 (≠ N64), D68 (= D65), L69 (= L66), W113 (≠ A101), F115 (≠ I103), S139 (≠ P127), W143 (≠ L131)
Sites not aligning to the query:
2uzfA Crystal structure of staphylococcus aureus 1,4-dihydroxy-2-naphthoyl coa synthase (menb) in complex with acetoacetyl coa (see paper)
28% identity, 95% coverage: 12:252/254 of query aligns to 17:255/260 of 2uzfA
- active site: G70 (≠ N64), R80 (≠ A74), L84 (≠ S78), G108 (≠ I105), V111 (≠ T108), T130 (≠ P127), G131 (≠ F128), S136 (≠ I133), D138 (≠ P135), A139 (≠ E136), A225 (≠ T220), Y233 (≠ L230)
- binding acetoacetyl-coenzyme a: V28 (≠ K23), R29 (≠ K24), S68 (≠ A62), G69 (= G63), G70 (≠ N64), D71 (= D65), Y104 (≠ A101), G108 (≠ I105)
Q9P4U9 Enoyl-CoA hydratase AKT3-1; AF-toxin biosynthesis protein 3-1; EC 4.2.1.17 from Alternaria alternata (Alternaria rot fungus) (Torula alternata) (see paper)
28% identity, 94% coverage: 12:250/254 of query aligns to 24:268/296 of Q9P4U9
Sites not aligning to the query:
- 294:296 Peroxisomal targeting signal type 1
Q4WF54 Mevalonyl-coenzyme A hydratase sidH; Siderophore biosynthesis protein H; EC 4.2.1.- from Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) (Neosartorya fumigata) (see paper)
28% identity, 94% coverage: 13:250/254 of query aligns to 21:265/270 of Q4WF54
Sites not aligning to the query:
- 268:270 PTS1-type peroxisomal targeting signal
6l3pA Crystal strcuture of feruloyl-coa hydratase lyase(fchl) complexed with coa
30% identity, 76% coverage: 8:201/254 of query aligns to 13:210/244 of 6l3pA
- active site: M69 (≠ N64), Y74 (≠ F69), R86 (≠ D81), Q90 (vs. gap), G114 (≠ I105), S117 (≠ T108), S136 (≠ P127), E137 (≠ F128), I142 (= I133), P144 (= P135), G145 (≠ E136)
- binding coenzyme a: K28 (= K23), R29 (≠ K24), A31 (= A26), A67 (= A62), M69 (≠ N64), D70 (= D65), L71 (= L66), G113 (= G104)
Sites not aligning to the query:
3p85A Crystal structure enoyl-coa hydratase from mycobacterium avium (see paper)
33% identity, 76% coverage: 3:196/254 of query aligns to 1:179/224 of 3p85A
- active site: L62 (≠ N64), L67 (vs. gap), P68 (= P67), G92 (≠ I105), E95 (≠ T108), T114 (≠ P127), H115 (≠ F128), L120 (≠ I133), P122 (= P135), T123 (≠ E136)
- binding calcium ion: D43 (= D45), D45 (= D47)
Sites not aligning to the query:
Query Sequence
>WP_011386482.1 NCBI__GCF_000009985.1:WP_011386482.1
MSELVLSHVEGGVQVVRMNRPDKKNALIGEMYAALAEAFAKGEADDDVNVFLILGSQTDF
SAGNDLPDFLTWEALSGSVADRFIRAVAGARKPVVAAVRGAAIGIGSTLLPHCDLVYAAP
GTRFHMPFINLGIVPEAGSSQTMPALAGHRRAAEMLMLGEPFGVDTAEAVGLINGVVPGE
DLEETAMAAARKLAAKPRSILVQIKALMKTPAEPIMDRLTREAAVFDTCLKGEALNEAVS
AFKEKRAPDFSKCR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory