SitesBLAST
Comparing WP_011386545.1 NCBI__GCF_000009985.1:WP_011386545.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8gy3C Cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans
31% identity, 94% coverage: 40:709/713 of query aligns to 15:718/732 of 8gy3C
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): M38 (= M63), G39 (= G64), Q40 (= Q65), H41 (≠ G66), V42 (= V67), A45 (≠ G70), G79 (= G110), G80 (= G111), S81 (= S112), S83 (≠ A114), V84 (≠ T115), G374 (≠ S391), F375 (= F392), L379 (≠ A396), L499 (≠ W510), R500 (= R511), V624 (= V615), D625 (≠ T616), Q632 (= Q623), T687 (= T678), G688 (= G679), L689 (≠ V680), G690 (= G681), E691 (= E682)
5y6qC Crystal structure of an aldehyde oxidase from methylobacillus sp. Ky4400 (see paper)
27% identity, 50% coverage: 200:552/713 of query aligns to 13:385/748 of 5y6qC
Sites not aligning to the query:
- active site: 715, 716
- binding pterin cytosine dinucleotide: 461, 462, 463, 464, 468, 500, 502, 503, 504, 505, 638, 640, 641, 648, 711, 713, 714, 715
1t3qB Crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86 (see paper)
24% identity, 50% coverage: 183:542/713 of query aligns to 8:402/786 of 1t3qB
Sites not aligning to the query:
- active site: 743, 744
- binding pterin cytosine dinucleotide: 506, 507, 508, 510, 513, 545, 547, 549, 550, 666, 670, 674, 675, 678, 739, 740, 741, 742
O33819 4-hydroxybenzoyl-CoA reductase subunit alpha; 4-HBCR subunit alpha; EC 1.1.7.1 from Thauera aromatica (see paper)
36% identity, 19% coverage: 572:709/713 of query aligns to 609:753/769 of O33819
Sites not aligning to the query:
- 214 binding
- 244:245 binding
- 522:526 binding
1rm6A Structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica (see paper)
36% identity, 19% coverage: 572:709/713 of query aligns to 601:745/761 of 1rm6A
- active site: E718 (≠ V685), G719 (≠ P686)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): L646 (≠ V615), N647 (≠ T616), V651 (= V620), Q654 (= Q623), K714 (≠ G681), E715 (= E682), A716 (≠ P683), S717 (≠ G684), E718 (≠ V685)
Sites not aligning to the query:
- active site: 206, 241, 318, 322, 350
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 235, 236, 237, 238, 350, 473, 474, 475, 476, 513, 514, 515, 517, 518
5g5gC Escherichia coli periplasmic aldehyde oxidase (see paper)
30% identity, 18% coverage: 584:709/713 of query aligns to 585:719/731 of 5g5gC
Sites not aligning to the query:
- active site: 211, 246, 316, 322, 350
- binding pterin cytosine dinucleotide: 240, 241, 242, 350, 468, 469, 470, 507, 509, 511, 512
P77489 Aldehyde oxidoreductase molybdenum-binding subunit PaoC; EC 1.2.99.6 from Escherichia coli (strain K12) (see 2 papers)
30% identity, 18% coverage: 584:709/713 of query aligns to 585:719/732 of P77489
- 615:621 (vs. 613:619, 14% identical) binding
- Q625 (= Q623) binding
- KGVG 688:691 (≠ -GVG 679:681) binding
- E692 (= E682) mutation to Q: Loss of activity.
Sites not aligning to the query:
- 241:242 binding
- 440 mutation R->H,K: Decrease in catalytic efficiency.
- 468:470 binding
- 511:512 binding
3hrdB Crystal structure of nicotinate dehydrogenase (see paper)
30% identity, 18% coverage: 583:709/713 of query aligns to 182:316/330 of 3hrdB
- active site: E289 (= E682), P290 (= P683)
- binding pterin cytosine dinucleotide: I215 (≠ V615), N216 (≠ T616), M219 (≠ V619), V220 (= V620), Q223 (= Q623), K285 (≠ T678), G286 (= G679), V287 (= V680), G288 (= G681), E289 (= E682)
Sites not aligning to the query:
Q0QLF1 Nicotinate dehydrogenase medium molybdopterin subunit; NDH; Nicotinic acid hydroxylase medium molybdopterin subunit; NAH; EC 1.17.1.5 from Eubacterium barkeri (Clostridium barkeri) (see paper)
30% identity, 18% coverage: 583:709/713 of query aligns to 182:316/330 of Q0QLF1
- 211:223 (vs. 611:623, 23% identical) binding
- AKGVGE 284:289 (≠ -TGVGE 678:682) binding
Sites not aligning to the query:
- 45:49 binding
- 85:90 binding
7dqxD Crystal structure of xanthine dehydrogenase family protein
25% identity, 49% coverage: 193:542/713 of query aligns to 6:394/770 of 7dqxD
Sites not aligning to the query:
- binding pterin cytosine dinucleotide: 491, 492, 493, 494, 498, 530, 531, 532, 533, 534, 535, 536, 658, 659, 662, 725, 726, 727, 728
1ffvB Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava (see paper)
23% identity, 49% coverage: 193:541/713 of query aligns to 12:409/797 of 1ffvB
- active site: Q231 (= Q363), V266 (≠ A396), P343 (= P478), I349 (≠ A484), R378 (≠ W510), C379 (≠ R511)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): G260 (= G390), G261 (≠ S391), F262 (= F392), G263 (= G393), A376 (≠ L508), R378 (≠ W510), C379 (≠ R511)
Sites not aligning to the query:
- active site: 751, 752
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 516, 517, 518, 520, 523, 556, 557, 558, 560, 561, 674, 678, 683, 686, 747, 748, 749, 750, 751
1ffuB Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor (see paper)
23% identity, 49% coverage: 193:541/713 of query aligns to 12:409/797 of 1ffuB
Sites not aligning to the query:
- active site: 751, 752
- binding cytidine-5'-diphosphate: 518, 520, 523, 558, 560, 561, 674, 676, 678, 683, 747, 748, 749, 750
P19913 Carbon monoxide dehydrogenase large chain; CO dehydrogenase subunit L; CO-DH L; EC 1.2.5.3 from Hydrogenophaga pseudoflava (Pseudomonas carboxydoflava) (see paper)
23% identity, 48% coverage: 200:541/713 of query aligns to 25:415/803 of P19913
- R384 (≠ W510) modified: 4-hydroxyarginine
4usaA Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with trans-cinnamaldehyde (see paper)
27% identity, 33% coverage: 307:541/713 of query aligns to 335:563/907 of 4usaA
- active site: I390 (≠ Q361), F425 (≠ A396), R501 (≠ E482), F505 (≠ N486), R533 (= R511)
- binding bicarbonate ion: R460 (= R433), A531 (vs. gap), F532 (≠ W510), Y535 (≠ V513), Q539 (≠ H517)
- binding hydrocinnamic acid: F425 (≠ A396), F494 (≠ G475), L497 (≠ P478), Y535 (≠ V513)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): T420 (≠ S391), F421 (= F392), G422 (= G393), R533 (= R511)
Sites not aligning to the query:
- active site: 869, 870
- binding fe2/s2 (inorganic) cluster: 38, 40, 41, 43, 45, 46, 48, 58, 60, 100, 101, 103, 137, 139
- binding hydrocinnamic acid: 255, 626
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 99, 139, 650, 653, 654, 655, 656, 695, 696, 697, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
4us9A Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with 3- phenylpropionaldehyde (see paper)
27% identity, 33% coverage: 307:541/713 of query aligns to 335:563/907 of 4us9A
- active site: I390 (≠ Q361), F425 (≠ A396), R501 (≠ E482), F505 (≠ N486), R533 (= R511)
- binding bicarbonate ion: R460 (= R433), L498 (≠ V479), A531 (vs. gap), F532 (≠ W510), Y535 (≠ V513), Q539 (≠ H517)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): T420 (≠ S391), F421 (= F392), G422 (= G393), R533 (= R511)
Sites not aligning to the query:
- active site: 869, 870
- binding 3-phenylpropanal: 255, 257, 258, 752
- binding bicarbonate ion: 890, 892
- binding fe2/s2 (inorganic) cluster: 38, 40, 41, 43, 45, 46, 48, 58, 60, 100, 101, 103, 137, 139
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 99, 139, 650, 653, 654, 655, 656, 695, 696, 697, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
4us8A Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with benzaldehyde (see paper)
27% identity, 33% coverage: 307:541/713 of query aligns to 335:563/907 of 4us8A
- active site: I390 (≠ Q361), F425 (≠ A396), R501 (≠ E482), F505 (≠ N486), R533 (= R511)
- binding bicarbonate ion: R460 (= R433), L498 (≠ V479), A531 (vs. gap), F532 (≠ W510), Y535 (≠ V513), Q539 (≠ H517)
- binding benzaldehyde: L394 (≠ H365), F425 (≠ A396), F425 (≠ A396), F425 (≠ A396), F425 (≠ A396), L497 (≠ P478), L497 (≠ P478), R501 (≠ E482), A531 (vs. gap), Y535 (≠ V513), Y535 (≠ V513)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): T420 (≠ S391), F421 (= F392), G422 (= G393), R533 (= R511)
Sites not aligning to the query:
- active site: 869, 870
- binding fe2/s2 (inorganic) cluster: 38, 40, 41, 43, 45, 46, 48, 58, 60, 100, 101, 103, 137, 139
- binding benzaldehyde: 255, 255, 626, 626, 626, 694, 696, 697
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 99, 139, 653, 654, 655, 656, 695, 696, 697, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
4c7yA Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with sodium dithionite and sodium sulfide (see paper)
27% identity, 33% coverage: 307:541/713 of query aligns to 335:563/907 of 4c7yA
- active site: I390 (≠ Q361), F425 (≠ A396), R501 (≠ E482), F505 (≠ N486), R533 (= R511)
- binding bicarbonate ion: R460 (= R433), L498 (≠ V479), A531 (vs. gap), Y535 (≠ V513), Q539 (≠ H517)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): T420 (≠ S391), F421 (= F392), G422 (= G393), R533 (= R511)
Sites not aligning to the query:
- active site: 869, 870
- binding fe2/s2 (inorganic) cluster: 40, 41, 43, 45, 46, 48, 58, 60, 100, 101, 103, 137, 139
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 99, 139, 650, 653, 654, 655, 656, 695, 696, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
- binding hydrogen peroxide: 696, 697, 869
3fc4A Ethylene glycol inhibited form of aldehyde oxidoreductase from desulfovibrio gigas (see paper)
27% identity, 33% coverage: 307:541/713 of query aligns to 335:563/907 of 3fc4A
- active site: I390 (≠ Q361), F425 (≠ A396), R501 (≠ E482), F505 (≠ N486), R533 (= R511)
- binding 1,2-ethanediol: Y535 (≠ V513)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): G419 (= G390), T420 (≠ S391), F421 (= F392), G422 (= G393), R533 (= R511)
Sites not aligning to the query:
- active site: 869, 870
- binding 1,2-ethanediol: 622, 696, 697, 869
- binding fe2/s2 (inorganic) cluster: 38, 40, 41, 43, 45, 46, 48, 58, 60, 100, 101, 103, 137, 139
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 99, 139, 650, 653, 654, 655, 656, 695, 696, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
3fahA Glycerol inhibited form of aldehyde oxidoreductase from desulfovibrio gigas (see paper)
27% identity, 33% coverage: 307:541/713 of query aligns to 335:563/907 of 3fahA
- active site: I390 (≠ Q361), F425 (≠ A396), R501 (≠ E482), F505 (≠ N486), R533 (= R511)
- binding glycerol: P416 (≠ L387), Y535 (≠ V513)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): G419 (= G390), T420 (≠ S391), F421 (= F392), G422 (= G393), R533 (= R511)
Sites not aligning to the query:
- active site: 869, 870
- binding fe2/s2 (inorganic) cluster: 38, 40, 41, 43, 45, 46, 48, 58, 60, 100, 101, 103, 137, 139
- binding glycerol: 622, 683, 696, 697, 869, 884, 889, 890, 892
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 99, 139, 650, 653, 654, 655, 656, 695, 696, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
1sijA Crystal structure of the aldehyde dehydrogenase (a.K.A. Aor or mop) of desulfovibrio gigas covalently bound to [aso3]- (see paper)
27% identity, 33% coverage: 307:541/713 of query aligns to 335:563/907 of 1sijA
Sites not aligning to the query:
- active site: 869, 870
- binding arsenite: 696, 697, 869
- binding fe2/s2 (inorganic) cluster: 38, 40, 41, 43, 45, 46, 48, 58, 60, 99, 100, 101, 103, 137, 139
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 99, 139, 653, 654, 655, 656, 695, 696, 698, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
Query Sequence
>WP_011386545.1 NCBI__GCF_000009985.1:WP_011386545.1
MKRAVPTGGIDRRTFLITTAGAGLALAVGDAHADTEAEGWRPNAFVAIGPDGKVTVTVKH
LEMGQGVATGLPVLVAEELEVDPAQVSVAFAPADAKRYNNLFWGPSQGTGGSTATANSWE
QLRLAGAAAREMLVEAAARILRADAASLSAVNGGVVHSPSGRRLGYGELVSVAAKLTPPS
APALKPASQFRLIGRDGVKRSDSRVKSDGTAQFGADLRLPGMLTALVARPPVWGARPDGH
DRKAALAVPGVMAVFPIPSGIAVAASSFWAAHKGREALNARWAEPADKVSTESLRRDWTA
LLGKAGRPAAARGDAEAILAQAAQRQSATYELPYLAHAPMEPLNCVVRLAPGKCEIWTGC
QFQTHDQAMAAKAAGLKPEQVEIHTMLAGGSFGRRANPTSDYIVEGVEVAKVLNTPVRLM
WTREDDIAGAYYRPMALHGFEAALDERGMPLAWRHRVVCQSILDGGPFAGMIKDGIDPVS
VEGASNLPYAIPNLAVDLHSPKAPVPVLWWRSVGSSHTAFATECFLDELAQAGGKDPLEL
RRALLADQPRHLAVLELAAAKAGWGSPLPAGKGRGIAVHESFHSFVAQVVEVSIGAKGEI
KVDRVVCAVDCGVAVTPDVVRAQMEGGIAFALSAALFGEITLKDGRAEQSNFHDYRCLRM
NEMPRVEVHIVPSAAPPTGVGEPGVPPLAPALANAIFAATGKRLRKLPLGEQV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory