SitesBLAST
Comparing WP_011386591.1 AMB_RS21445 acetyl/propionyl/methylcrotonyl-CoA carboxylase subunit alpha to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q5LUF3 Propionyl-CoA carboxylase alpha chain; EC 6.4.1.3 from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) (Silicibacter pomeroyi) (see paper)
61% identity, 100% coverage: 1:661/663 of query aligns to 1:680/681 of Q5LUF3
- F348 (= F349) binding
- W515 (= W497) mutation to L: No effect on holoenzyme formation.
- L599 (≠ M580) mutation to A: Loss of holoenzyme formation; when associated with A-602 and A-603.
- L602 (= L583) mutation to A: Loss of holoenzyme formation; when associated with A-602 and A-603.
- M603 (= M584) mutation to A: No effect on holoenzyme formation. Loss of holoenzyme formation; when associated with A-602 and A-603.
- K647 (= K628) modified: N6-biotinyllysine
3n6rG Crystal structure of the holoenzyme of propionyl-coa carboxylase (pcc) (see paper)
61% identity, 100% coverage: 2:661/663 of query aligns to 1:645/646 of 3n6rG
- active site: K115 (= K116), K157 (= K158), D180 (= D195), H193 (= H208), R219 (= R234), T258 (= T273), E260 (= E275), E273 (= E289), N275 (= N291), R277 (= R293), E281 (= E297), R323 (= R339), G519 (= G535)
- binding 5-(hexahydro-2-oxo-1h-thieno[3,4-d]imidazol-6-yl)pentanal: M611 (= M627), K612 (= K628)
7ybuA Human propionyl-coenzyme a carboxylase
52% identity, 100% coverage: 2:661/663 of query aligns to 5:669/670 of 7ybuA
P05165 Propionyl-CoA carboxylase alpha chain, mitochondrial; PCCase subunit alpha; Propanoyl-CoA:carbon dioxide ligase subunit alpha; EC 6.4.1.3 from Homo sapiens (Human) (see 6 papers)
52% identity, 100% coverage: 2:661/663 of query aligns to 63:727/728 of P05165
- A75 (= A14) to P: in PA-1; dbSNP:rs794727479
- R77 (= R16) to W: in PA-1; loss of function; dbSNP:rs141371306
- A138 (= A77) to T: in PA-1; loss of function; dbSNP:rs202247814
- I164 (= I103) to T: in PA-1; loss of function; dbSNP:rs202247815
- G197 (= G136) to E: in PA-1
- M229 (= M168) to K: in PA-1; dbSNP:rs375628794
- Q297 (= Q236) to R: in PA-1
- D368 (= D308) to G: in PA-1
- M373 (= M313) to K: in PA-1; unstable protein; loss of function; dbSNP:rs121964958
- G379 (= G319) to V: in PA-1; dbSNP:rs794727087
- C398 (≠ A338) to R: in PA-1
- R399 (= R339) to Q: in PA-1; dbSNP:rs1301904623
- P423 (= P362) to L: in PA-1; dbSNP:rs1443858896
- L532 (≠ T480) natural variant: Missing (in PA-1)
- V551 (= V499) to F: in dbSNP:rs61749895
- W559 (vs. gap) to L: in PA-1; dbSNP:rs118169528
- G631 (= G565) to R: in PA-1; loss of function; dbSNP:rs796052018
- G668 (= G602) to R: in PA-1; loss of biotinylation; dbSNP:rs771438170
- K694 (= K628) modified: N6-biotinyllysine; by HLCS
- C712 (≠ A646) natural variant: Missing (in PA-1; loss of biotinylation)
Sites not aligning to the query:
- 1:52 modified: transit peptide, Mitochondrion
8sgxX Leishmania tarentolae propionyl-coa carboxylase (alpha-4-beta-6) (see paper)
50% identity, 99% coverage: 5:661/663 of query aligns to 1:656/657 of 8sgxX
3n6rA Crystal structure of the holoenzyme of propionyl-coa carboxylase (pcc) (see paper)
51% identity, 100% coverage: 2:661/663 of query aligns to 1:590/591 of 3n6rA
- active site: K115 (= K116), H138 (≠ E150), R164 (≠ G180), T203 (= T273), E205 (= E275), E218 (= E289), N220 (= N291), R222 (= R293), E226 (= E297), R268 (= R339), G464 (= G535)
- binding 5-(hexahydro-2-oxo-1h-thieno[3,4-d]imidazol-6-yl)pentanal: M556 (= M627), K557 (= K628)
P9WPQ3 Biotin-dependent 3-methylcrotonyl-coenzyme A carboxylase alpha1 subunit; EC 6.3.4.14 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
44% identity, 99% coverage: 1:656/663 of query aligns to 1:647/654 of P9WPQ3
- K322 (= K321) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
2vr1A Crystal structure of biotin carboxylase from e. Coli in complex with atp analog, adpcf2p. (see paper)
50% identity, 67% coverage: 1:443/663 of query aligns to 1:438/444 of 2vr1A
- active site: K116 (= K116), K159 (= K158), D194 (= D195), H207 (= H208), R233 (= R234), T272 (= T273), E274 (= E275), E286 (= E289), N288 (= N291), R290 (= R293), E294 (= E297), R336 (= R339)
- binding phosphodifluoromethylphosphonic acid-adenylate ester: K159 (= K158), R165 (≠ K166), M167 (= M168), Y201 (≠ F202), L202 (≠ I203), E274 (= E275), L276 (≠ I277), E286 (= E289), N288 (= N291), I435 (≠ T440)
3jziA Crystal structure of biotin carboxylase from e. Coli in complex with benzimidazole series (see paper)
51% identity, 67% coverage: 1:443/663 of query aligns to 1:440/445 of 3jziA
- active site: K116 (= K116), K159 (= K158), D196 (= D195), H209 (= H208), R235 (= R234), T274 (= T273), E276 (= E275), E288 (= E289), N290 (= N291), R292 (= R293), E296 (= E297), R338 (= R339)
- binding 7-amino-2-[(2-chlorobenzyl)amino]-1-{[(1S,2S)-2-hydroxycycloheptyl]methyl}-1H-benzimidazole-5-carboxamide: K116 (= K116), K159 (= K158), A160 (= A159), G164 (= G163), G165 (= G164), M169 (= M168), Y199 (≠ F198), E201 (= E200), K202 (= K201), Y203 (≠ F202), H209 (= H208), Q233 (= Q232), H236 (= H235), L278 (≠ I277), I287 (≠ L288), E288 (= E289)
2w6oA Crystal structure of biotin carboxylase from e. Coli in complex with 4-amino-7,7-dimethyl-7,8-dihydro-quinazolinone fragment (see paper)
51% identity, 67% coverage: 1:443/663 of query aligns to 1:440/445 of 2w6oA
- active site: K116 (= K116), K159 (= K158), D196 (= D195), H209 (= H208), R235 (= R234), T274 (= T273), E276 (= E275), E288 (= E289), N290 (= N291), R292 (= R293), E296 (= E297), R338 (= R339)
- binding 4-amino-7,7-dimethyl-7,8-dihydroquinazolin-5(6H)-one: K159 (= K158), K202 (= K201), Y203 (≠ F202), L204 (≠ I203), L278 (≠ I277), I437 (≠ T440)
2w6nA Crystal structure of biotin carboxylase from e. Coli in complex with amino-oxazole fragment series (see paper)
51% identity, 67% coverage: 1:443/663 of query aligns to 1:440/445 of 2w6nA
- active site: K116 (= K116), K159 (= K158), D196 (= D195), H209 (= H208), R235 (= R234), T274 (= T273), E276 (= E275), E288 (= E289), N290 (= N291), R292 (= R293), E296 (= E297), R338 (= R339)
- binding 2-amino-n,n-bis(phenylmethyl)-1,3-oxazole-5-carboxamide: I157 (≠ M156), K159 (= K158), M169 (= M168), E201 (= E200), K202 (= K201), Y203 (≠ F202), L278 (≠ I277)
2v59A Crystal structure of biotin carboxylase from e.Coli in complex with potent inhibitor 2 (see paper)
51% identity, 67% coverage: 1:443/663 of query aligns to 1:440/445 of 2v59A
- active site: K116 (= K116), K159 (= K158), D196 (= D195), H209 (= H208), R235 (= R234), T274 (= T273), E276 (= E275), E288 (= E289), N290 (= N291), R292 (= R293), E296 (= E297), R338 (= R339)
- binding 6-(2,6-dimethoxyphenyl)pyrido[2,3-d]pyrimidine-2,7-diamine: K159 (= K158), Y203 (≠ F202), L204 (≠ I203), H209 (= H208), Q233 (= Q232), H236 (= H235), L278 (≠ I277), I437 (≠ T440)
6oi9A Crystal structure of e. Coli biotin carboxylase complexed with 7-[3- (aminomethyl)pyrrolidin-1-yl]-6-(2,6-dichlorophenyl)pyrido[2,3- d]pyrimidin-2-amine (see paper)
51% identity, 67% coverage: 1:443/663 of query aligns to 1:440/446 of 6oi9A
- active site: E276 (= E275), E288 (= E289), N290 (= N291), E296 (= E297), R338 (= R339)
- binding 7-[(3S)-3-(aminomethyl)pyrrolidin-1-yl]-6-(2,6-dichlorophenyl)pyrido[2,3-d]pyrimidin-2-amine: K159 (= K158), M169 (= M168), E201 (= E200), Y203 (≠ F202), L204 (≠ I203), H209 (= H208), Q233 (= Q232), H236 (= H235), E276 (= E275), L278 (≠ I277), E288 (= E289), I437 (≠ T440)
2w71A Crystal structure of biotin carboxylase from e. Coli in complex with the imidazole-pyrimidine inhibitor (see paper)
51% identity, 67% coverage: 1:443/663 of query aligns to 1:440/446 of 2w71A
- active site: K116 (= K116), K159 (= K158), D196 (= D195), H209 (= H208), R235 (= R234), T274 (= T273), E276 (= E275), E288 (= E289), N290 (= N291), R292 (= R293), E296 (= E297), R338 (= R339)
- binding 4-[1-(2,6-dichlorobenzyl)-2-methyl-1H-imidazol-4-yl]pyrimidin-2-amine: K159 (= K158), Y203 (≠ F202), L204 (≠ I203), H209 (= H208), Q233 (= Q232), H236 (= H235), L278 (≠ I277), I437 (≠ T440)
2w70A Crystal structure of biotin carboxylase from e. Coli in complex with the amino-thiazole-pyrimidine fragment (see paper)
51% identity, 67% coverage: 1:443/663 of query aligns to 1:440/446 of 2w70A
- active site: K116 (= K116), K159 (= K158), D196 (= D195), H209 (= H208), R235 (= R234), T274 (= T273), E276 (= E275), E288 (= E289), N290 (= N291), R292 (= R293), E296 (= E297), R338 (= R339)
- binding 4-(2-amino-1,3-thiazol-4-yl)pyrimidin-2-amine: I157 (≠ M156), K159 (= K158), G166 (= G165), M169 (= M168), E201 (= E200), Y203 (≠ F202), L204 (≠ I203), L278 (≠ I277)
2w6zA Crystal structure of biotin carboxylase from e. Coli in complex with the 3-(3-methyl-but-2-enyl)-3h-purin-6-ylamine fragment (see paper)
51% identity, 67% coverage: 1:443/663 of query aligns to 1:440/446 of 2w6zA
- active site: K116 (= K116), K159 (= K158), D196 (= D195), H209 (= H208), R235 (= R234), T274 (= T273), E276 (= E275), E288 (= E289), N290 (= N291), R292 (= R293), E296 (= E297), R338 (= R339)
- binding 3-(3-methylbut-2-en-1-yl)-3H-purin-6-amine: K159 (= K158), Y203 (≠ F202), L204 (≠ I203), L278 (≠ I277)
2w6qA Crystal structure of biotin carboxylase from e. Coli in complex with the triazine-2,4-diamine fragment (see paper)
51% identity, 67% coverage: 1:443/663 of query aligns to 1:440/446 of 2w6qA
- active site: K116 (= K116), K159 (= K158), D196 (= D195), H209 (= H208), R235 (= R234), T274 (= T273), E276 (= E275), E288 (= E289), N290 (= N291), R292 (= R293), E296 (= E297), R338 (= R339)
- binding 6-(2-phenoxyethoxy)-1,3,5-triazine-2,4-diamine: I157 (≠ M156), K159 (= K158), E201 (= E200), K202 (= K201), Y203 (≠ F202), L204 (≠ I203), H236 (= H235), L278 (≠ I277)
2w6pA Crystal structure of biotin carboxylase from e. Coli in complex with 5-methyl-6-phenyl-quinazoline-2,4-diamine (see paper)
51% identity, 67% coverage: 1:443/663 of query aligns to 1:440/446 of 2w6pA
- active site: K116 (= K116), K159 (= K158), D196 (= D195), H209 (= H208), R235 (= R234), T274 (= T273), E276 (= E275), E288 (= E289), N290 (= N291), R292 (= R293), E296 (= E297), R338 (= R339)
- binding 5-methyl-6-phenylquinazoline-2,4-diamine: K159 (= K158), Y203 (≠ F202), L204 (≠ I203), Q233 (= Q232), H236 (= H235), L278 (≠ I277), I437 (≠ T440)
2w6mA Crystal structure of biotin carboxylase from e. Coli in complex with amino-oxazole fragment series (see paper)
51% identity, 67% coverage: 1:443/663 of query aligns to 1:440/446 of 2w6mA
- active site: K116 (= K116), K159 (= K158), D196 (= D195), H209 (= H208), R235 (= R234), T274 (= T273), E276 (= E275), E288 (= E289), N290 (= N291), R292 (= R293), E296 (= E297), R338 (= R339)
- binding (2-amino-1,3-oxazol-5-yl)-(3-bromophenyl)methanone: I157 (≠ M156), K159 (= K158), M169 (= M168), E201 (= E200), K202 (= K201), Y203 (≠ F202), H236 (= H235), L278 (≠ I277), I437 (≠ T440)
2v5aA Crystal structure of biotin carboxylase from e.Coli in complex with potent inhibitor 3 (see paper)
51% identity, 67% coverage: 1:443/663 of query aligns to 1:440/446 of 2v5aA
- active site: K116 (= K116), K159 (= K158), D196 (= D195), H209 (= H208), R235 (= R234), T274 (= T273), E276 (= E275), E288 (= E289), N290 (= N291), R292 (= R293), E296 (= E297), R338 (= R339)
- binding 7-(2,5-dihydropyrrol-1-yl)-6-phenyl-pyrido[6,5-d]pyrimidin-2-amine: I157 (≠ M156), K159 (= K158), M169 (= M168), E201 (= E200), Y203 (≠ F202), L204 (≠ I203), Q233 (= Q232), H236 (= H235), L278 (≠ I277), I437 (≠ T440)
Query Sequence
>WP_011386591.1 AMB_RS21445 acetyl/propionyl/methylcrotonyl-CoA carboxylase subunit alpha
MFTKILIANRGEIACRVIKTAKKMGIKTVAVYSDADKDALHVSMADEAVHIGPAASAQSY
LVIDKIVDACKQTGAQAVHPGYGFLSEKREFQEALGKAGIAFIGPDAHAIFAMGDKIESK
KLAREAGVNTVPGYLGVIKDADEAVKIAREIGYPVMLKASAGGGGKGMRLAWNDAEAHEG
FTSATNEAKTSFGDDRVFVEKFIEQPRHIEIQVLADGQGTTLYLGERECSIQRRHQKVIE
EAPSPFLTPETRKAMGEQACALARIVNYKSAGTVEFIVGGATGEFYFLEMNTRLQVEHPV
TEMITGLDLVEQMIRVASGEKLSITQDDVKLNGWSMEARVYAEDPFRNFLPSTGRLTRYQ
PPAESAHVRVDTGVYEGGEISMFYDPMIAKLITYGPTRDAAIAHMRQALDEYYIRGLSHN
IPFLASLFSKERFVKGALTTNFIAEEYANGFHANDLPADDPTVLIAVAAAANRRIHERDT
RISGQFPGHEMKAGDEWVVVMSGQYHDITVRPAENGYAVALGGETVDVRTDWQIGEPLFR
ANVDGRAVAVQIERVGSGLRLAHAGSRVDVLVLTPHAAKMNKLMPFKAPPDMSKYLLSPM
PGLLVKLLVEAGQEVKAGEPLAVVEAMKMENILKAERDATVAKTHAASGDSLAVDQKIIE
FAS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory