Comparing WP_011386726.1 NCBI__GCF_000009985.1:WP_011386726.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1h2fA Bacillus stearothermophilus phoe (previously known as yhfr) in complex with trivanadate (see paper)
33% identity, 83% coverage: 3:166/197 of query aligns to 3:162/207 of 1h2fA
Sites not aligning to the query:
1h2eA Bacillus stearothermophilus phoe (previously known as yhfr) in complex with phosphate (see paper)
33% identity, 83% coverage: 3:166/197 of query aligns to 3:162/207 of 1h2eA
4ij6A Crystal structure of a novel-type phosphoserine phosphatase mutant (h9a) from hydrogenobacter thermophilus tk-6 in complex with l-phosphoserine (see paper)
31% identity, 85% coverage: 1:168/197 of query aligns to 1:161/207 of 4ij6A
5hr5A Bovine heart 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase (pfkfb2) (see paper)
28% identity, 83% coverage: 3:165/197 of query aligns to 225:376/424 of 5hr5A
Sites not aligning to the query:
P26285 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2; 6PF-2-K/Fru-2,6-P2ase 2; PFK/FBPase 2; 6PF-2-K/Fru-2,6-P2ase heart-type isozyme; EC 2.7.1.105; EC 3.1.3.46 from Bos taurus (Bovine) (see paper)
28% identity, 83% coverage: 3:165/197 of query aligns to 252:403/531 of P26285
Sites not aligning to the query:
5htkA Human heart 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase (pfkfb2) (see paper)
29% identity, 83% coverage: 3:165/197 of query aligns to 221:372/425 of 5htkA
Sites not aligning to the query:
O60825 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2; 6PF-2-K/Fru-2,6-P2ase 2; PFK/FBPase 2; 6PF-2-K/Fru-2,6-P2ase heart-type isozyme; EC 2.7.1.105; EC 3.1.3.46 from Homo sapiens (Human) (see 2 papers)
29% identity, 83% coverage: 3:165/197 of query aligns to 251:402/505 of O60825
Sites not aligning to the query:
1bifA 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase bifunctional enzyme complexed with atp-g-s and phosphate (see paper)
27% identity, 83% coverage: 3:165/197 of query aligns to 214:365/432 of 1bifA
Sites not aligning to the query:
P9WIC7 Glucosyl-3-phosphoglycerate phosphatase; Mannosyl-3-phosphoglycerate phosphatase; EC 3.1.3.85; EC 3.1.3.70 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
34% identity, 77% coverage: 4:155/197 of query aligns to 6:160/223 of P9WIC7
Sites not aligning to the query:
4pzaB The complex structure of mycobacterial glucosyl-3-phosphoglycerate phosphatase rv2419c with inorganic phosphate (see paper)
34% identity, 77% coverage: 4:155/197 of query aligns to 5:159/217 of 4pzaB
4qihA The structure of mycobacterial glucosyl-3-phosphoglycerate phosphatase rv2419c complexes with vo3 (see paper)
34% identity, 77% coverage: 4:155/197 of query aligns to 4:158/209 of 4qihA
3fdzA Crystal structure of phosphoglyceromutase from burkholderia pseudomallei 1710b with bound 2,3-diphosphoglyceric acid and 3- phosphoglyceric acid (see paper)
37% identity, 54% coverage: 1:107/197 of query aligns to 1:105/230 of 3fdzA
Sites not aligning to the query:
3gp5A Crystal structure of phosphoglyceromutase from burkholderia pseudomallei with 3-phosphoglyceric acid and vanadate (see paper)
37% identity, 54% coverage: 1:107/197 of query aligns to 1:105/248 of 3gp5A
Sites not aligning to the query:
3gp3A Crystal structure of phosphoglyceromutase from burkholderia pseudomallei with 2-phosphoserine (see paper)
37% identity, 54% coverage: 1:107/197 of query aligns to 1:105/229 of 3gp3A
Sites not aligning to the query:
Q3JWH7 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase; BPG-dependent PGAM; PGAM; Phosphoglyceromutase; dPGM; EC 5.4.2.11 from Burkholderia pseudomallei (strain 1710b) (see paper)
37% identity, 54% coverage: 1:107/197 of query aligns to 1:105/249 of Q3JWH7
Sites not aligning to the query:
P36136 Sedoheptulose 1,7-bisphosphatase; EC 3.1.3.37 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
29% identity, 71% coverage: 2:141/197 of query aligns to 6:153/271 of P36136
Sites not aligning to the query:
3lg2A A ykr043c/ fructose-1,6-bisphosphate product complex following ligand soaking (see paper)
29% identity, 71% coverage: 2:141/197 of query aligns to 4:151/269 of 3lg2A
Sites not aligning to the query:
6m1xC Crystal structure of phosphoserine phosphatase in complex with 3- phosphoglyceric acid from entamoeba histolytica (see paper)
30% identity, 79% coverage: 1:155/197 of query aligns to 1:147/196 of 6m1xC
P25114 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4; 6PF-2-K/Fru-2,6-P2ase 4; PFK/FBPase 4; 6PF-2-K/Fru-2,6-P2ase testis-type isozyme; EC 2.7.1.105; EC 3.1.3.46 from Rattus norvegicus (Rat) (see 2 papers)
26% identity, 83% coverage: 3:165/197 of query aligns to 251:402/469 of P25114
Sites not aligning to the query:
3oi7A Structure of the structure of the h13a mutant of ykr043c in complex with sedoheptulose-1,7-bisphosphate (see paper)
28% identity, 71% coverage: 2:141/197 of query aligns to 3:150/260 of 3oi7A
Sites not aligning to the query:
>WP_011386726.1 NCBI__GCF_000009985.1:WP_011386726.1
MPTVILVRHGETVWNREGRVQGHGDSPLTPKGAAQARAYGRKLRQMLGDAGGWRVVSSPL
GRCAQTTGILCEVAELDFRSITFDDRLREVHTGQWSGLPKAELAARHPGMLEGEGLDHWV
FRCPGGESHHDVASRLAHWLADLAPGDKVIAVSHGIAGRVLRGLYSRLDPDLAMRGDSPQ
DVLFLMSKGCIERIGSE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory