Comparing WP_011386731.1 AMB_RS22185 ABC transporter ATP-binding protein to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8j5qD Cryo-em structure of mycobacterium tuberculosis oppabcd in the pre- translocation state (see paper)
39% identity, 98% coverage: 5:526/533 of query aligns to 1:601/611 of 8j5qD
8j5tD Cryo-em structure of mycobacterium tuberculosis oppabcd in the catalytic intermediate state (see paper)
49% identity, 48% coverage: 5:260/533 of query aligns to 1:259/608 of 8j5tD
Sites not aligning to the query:
8j5sD Cryo-em structure of mycobacterium tuberculosis oppabcd in the pre- catalytic intermediate state (see paper)
49% identity, 48% coverage: 5:260/533 of query aligns to 1:259/608 of 8j5sD
Sites not aligning to the query:
P0AAH4 Putrescine export system ATP-binding protein SapD from Escherichia coli (strain K12) (see paper)
37% identity, 49% coverage: 6:266/533 of query aligns to 2:273/330 of P0AAH4
7z15I E. Coli c-p lyase bound to a phnk/phnl dual abc dimer and adp + pi (see paper)
43% identity, 44% coverage: 298:531/533 of query aligns to 17:251/253 of 7z15I
Sites not aligning to the query:
7z18I E. Coli c-p lyase bound to a phnk abc dimer and atp (see paper)
44% identity, 43% coverage: 298:528/533 of query aligns to 17:248/250 of 7z18I
Sites not aligning to the query:
7z16I E. Coli c-p lyase bound to phnk/phnl dual abc dimer with amppnp and phnk e171q mutation (see paper)
43% identity, 43% coverage: 298:528/533 of query aligns to 17:248/250 of 7z16I
Sites not aligning to the query:
Q8RDH4 Dipeptide transport ATP-binding protein DppD; EC 7.4.2.9 from Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) (Thermoanaerobacter tengcongensis) (see paper)
38% identity, 47% coverage: 7:257/533 of query aligns to 4:257/326 of Q8RDH4
Sites not aligning to the query:
4fwiB Crystal structure of the nucleotide-binding domain of a dipeptide abc transporter (see paper)
39% identity, 47% coverage: 10:257/533 of query aligns to 6:256/310 of 4fwiB
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
38% identity, 45% coverage: 20:257/533 of query aligns to 18:243/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
38% identity, 45% coverage: 20:257/533 of query aligns to 19:244/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
38% identity, 45% coverage: 20:257/533 of query aligns to 19:244/344 of 3tuiC
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
38% identity, 45% coverage: 20:257/533 of query aligns to 19:244/344 of 6cvlD
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
35% identity, 47% coverage: 273:524/533 of query aligns to 2:236/241 of 4u00A
3c4jA Abc protein artp in complex with atp-gamma-s
37% identity, 47% coverage: 7:256/533 of query aligns to 3:239/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
37% identity, 47% coverage: 7:256/533 of query aligns to 3:239/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
37% identity, 47% coverage: 7:256/533 of query aligns to 3:239/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
37% identity, 47% coverage: 7:256/533 of query aligns to 3:239/242 of 2oljA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
32% identity, 44% coverage: 292:525/533 of query aligns to 9:237/240 of 4ymuJ
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
32% identity, 45% coverage: 286:524/533 of query aligns to 29:263/382 of 7ahhC
Sites not aligning to the query:
>WP_011386731.1 AMB_RS22185 ABC transporter ATP-binding protein
MSENTPLLVVDDLAVSFGPVQAVKGVSFTLAKGETLALVGESGSGKSVTALSILQLLPYP
RATHPRGSIRLDGAELVGAPEPALRKVRGGRIAMVFQEPMTSLNPLHSIEAQVGEVLELH
LGLRGSTLRDRVVELLSLVGIPEPEKRLGALPHELSGGQRQRVMIAMALAGEPDILIADE
PTTALDVTIQAQILALLKGLQARLGMALLFITHDLGIVRKMADRVCVMNAGEIVESGPLP
QVFDAPAHPYTQRLLAAEPKGKPHRAGEGEPVVMAARDLKVWFPLKAGLWRKTVGHVKAV
DGISLDLKRGHTIGVVGESGSGKTTLGLALLRLLDSDGEISFGGTRIESMSAGTLRPLRR
QMQMVFQDPYGSLSPRMSVGQIVGEGLEVHEPAMHAAERDRLIAAALEEVGLDPATRDRY
PHEFSGGQRQRIAIARALVLKPKFIVLDEPTSALDVSVQAQIVDLLRDLQARHALAYLFI
SHDLRVVRALADDLLVMKDGKVVEAGRADELFKAPRTAYTRALMAAAFDLEVA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory